HHsearch results for GI: 254780227 and protein with PDBid: 2w7t_A

>2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei}
Probab=90.11  E-value=0.84  Score=23.22  Aligned_cols=74  Identities=16%  Similarity=0.177  Sum_probs=47.5

Q ss_pred             HHHHHHHCCCCEEEEECCHHH--HHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             999998639988999488257--899999999998518996288522223477222114633565999999999999987
Q gi|254780227|r  130 SAHHLMQSGVTILHTIGGDDT--NTTACDLLRYLKEKNYNITVVGLPKTIDNDIIPIHQSLGALTAAQVSACFFDNISNE  207 (426)
Q Consensus       130 ~~~~l~~~~Id~Li~IGGdgS--~~~a~~L~e~~~~~~~~i~vigiPKTIDNDi~~td~tiGfdTA~~~~a~~i~~l~~~  207 (426)
                      +.+.|  .+.|++++-||.|+  ..+...-.+|++++  +||..|             .|+||+.|+=..+.-+-.+ .+
T Consensus        61 ~~~~L--~~~dGIlvpgGFG~RG~eGkI~Ai~yARen--~iPfLG-------------IClGmQ~avIEfARnvlg~-~d  122 (273)
T 2w7t_A           61 ARKAL--LGCDGIFVPGGFGNRGVDGKCAAAQVARMN--NIPYFG-------------VXLGMQVAVIELSRNVVGW-SD  122 (273)
T ss_dssp             HHHHH--HTCSEEEECCCCTTTTHHHHHHHHHHHHHH--TCCEEE-------------ETHHHHHHHHHHHHHTTCC-TT
T ss_pred             HHHHH--CCCCCEEECCCCCCCCHHHHHHHHHHHHHC--CCCCHH-------------HHHHHHHHHHHHHHHHCCC-CC
T ss_conf             99874--257746858857877647899999999974--886024-------------5566799999999987398-66


Q ss_pred             HHHCC----CCEEEEEEC
Q ss_conf             75166----616999976
Q gi|254780227|r  208 RSATP----RSLIIHEVM  221 (426)
Q Consensus       208 A~s~~----~~~~iVEvM  221 (426)
                      |.|..    ...-++-.|
T Consensus       123 A~s~E~~~~~~~~vi~~l  140 (273)
T 2w7t_A          123 ANSEEFNKESTHQVVRIM  140 (273)
T ss_dssp             CEETTTCTTCSCEEEECC
T ss_pred             CCHHHCCCCCCCCCEEEC
T ss_conf             536442899999836642