PSIBLAST alignment of GI: 254780227 and protein with PDB id: 1kzh

gi|21465959|pdb|1KZH|A Chain A, Structure Of A Pyrophosphate-Dependent Phosphofructokinase From The Lyme Disease Spirochete Borrelia Burgdorferi Length = 555
>gi|21465960|pdb|1KZH|B Chain B, Structure Of A Pyrophosphate-Dependent Phosphofructokinase From The Lyme Disease Spirochete Borrelia Burgdorferi Length = 555
 Score =  233 bits (595), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 81/428 (18%), Positives = 152/428 (35%), Gaps = 69/428 (16%)

Query: 31  KVAFLTAGGIAPCLSSIIGMLINHYNKILPKAELIYYRFGYQGLLLDDKITITEDMRQNA 90
            +  + +GG AP   ++I  + +   K  P ++L  ++ G  GLL +DKI +TE +  + 
Sbjct: 74  NIGIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSY 133

Query: 91  EQLLSYGGSPIGNSRVKLTNFSDCIKRGLIKKDENPLEVSAHHLMQSGVTILHTIGGDDT 150
               + G   + + R K+             + E     +     ++ +  +  IGGDD+
Sbjct: 134 RN--TGGFDIVSSGRTKI-------------ETEEHYNKALFVAKENNLNAIIIIGGDDS 178

Query: 151 NTTACDLLRYLKEKNYNITVVGLPKTIDNDII--PIHQSLGALTAAQVSACFFDNISNER 208