RPSBLAST alignment of GI: 254780227 and MMDB domain: 3pfk_A_132-250_306-319

>3pfk_A (A:132-250,A:306-319) Phosphofructokinase; transferase(phosphotransferase); 2.40A {Bacillus stearothermophilus}Length = 133
 Score = 74.9 bits (184), Expect = 2e-14
 Identities = 31/141 (21%), Positives = 58/141 (41%), Gaps = 24/141 (17%)

Query: 187 SLGALTAAQVSACFFDNISNERSATPRSLIIHEVMGRNCGWLTAYSAHCYLNMIQDRNYI 246
           ++G  TA        D I +  ++  R+ +I EVMGR+ G +  +S              
Sbjct: 5   TIGFDTALNTVIDAIDKIRDTATSHERTYVI-EVMGRHAGDIALWSGLA----------- 52

Query: 247 DGFIFSPDFKGIDGVYLPEMSFNLEVEIERLSKVMEK-KGSVAIFVSEGACRDVIMDNRL 305
                     G + + +PE  +++   I RL +  E+ K    I V+EG    V    ++
Sbjct: 53  ---------GGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQI 103

Query: 306 S--SGEKIKRDSFGHILLDKM 324
              +G + +    GH++  +M
Sbjct: 104 QEATGFETRVTVLGHVIDQRM 124