HHsearch alignment for GI: 254780229 and conserved domain: COG3973

>COG3973 Superfamily I DNA and RNA helicases [General function prediction only].
Probab=96.36  E-value=0.019  Score=40.48  Aligned_cols=68  Identities=22%  Similarity=0.316  Sum_probs=51.9

Q ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCHHHH-HHHHHHHHHC------CCEEEEEECCHHHHHHHHHHHHHCCCCCEE
Q ss_conf             468999998514895599428787703899-9999999967------982899601058999999864435844136
Q gi|254780229|r  407 SSQHSAVIDVINGKNLIIEGPPGTGKSQTI-TNIIAAAMLH------GKKILFCAQKMAAIEVVRHRLEKAGLGEFC  476 (1775)
Q Consensus       407 sSQ~~av~~~~~g~~~vi~GPPGTGKSQTI-aNlIa~~la~------Gk~VLfVaeK~aALdVV~~RL~~~gLg~~c  476 (1775)
T Consensus       215 kEQneIIR~e-k~~ilVVQGaAGSGKT-tiALHRvAyLlY~~R~~l~~k~vlvl~PN~vFleYis~VLPeLGe~~V~  289 (747)
T COG3973         215 KEQNEIIRFE-KNKILVVQGAAGSGKT-TIALHRVAYLLYGYRGPLQAKPVLVLGPNRVFLEYISRVLPELGEEGVV  289 (747)
T ss_pred             HHHHHHHHCC-CCCEEEEECCCCCCCH-HHHHHHHHHHHHCCCCCCCCCCEEEECCCHHHHHHHHHHCHHHCCCCEE
T ss_conf             7677787555-7874899558888713-5889999999853566246686599828389999998755441668636