HHsearch alignment for GI: 254780229 and conserved domain: KOG1805

>KOG1805 consensus.
Probab=99.91  E-value=4.5e-23  Score=255.50  Aligned_cols=242  Identities=25%  Similarity=0.376  Sum_probs=180.9

Q ss_pred             CCEEEECHHHHHHHCCCCCCCCCEEEECCHHHCCHHHHHHHHHHCCEEEEEECCCCCCCCHHHHHCCCCCCCCCCHHHCC
Q ss_conf             67899257799872585225410788606323698998898861182899607786686201100013444432011014
Q gi|254780229|r 1341 KPCFMMSPMSVANYLEPKDVKFDLVIMDESSQIKPEDALGVIARGKQIVVVGDPKQLPPTRFFDHDNDQEDYDEEVAAVS 1420 (1775)
Q Consensus      1341 ~P~~~msp~sva~~l~~~~~~FD~VI~DEASQ~~~~~al~al~rakqvvvvGD~kQlpPt~ff~~~~~~~~~~~~~~~~~ 1420 (1775)
T Consensus       777 ~~IVa~TClgi~~plf~~R-~FD~cIiDEASQI~lP~~LgPL~~s~kFVLVGDh~QLpPLV---~s~ea-------r~~G  845 (1100)
T KOG1805         777 TSIVACTCLGINHPLFVNR-QFDYCIIDEASQILLPLCLGPLSFSNKFVLVGDHYQLPPLV---RSSEA-------RQEG  845 (1100)
T ss_pred             CCEEEEECCCCCCHHHHCC-CCCEEEECCCCCCCCCHHHHHHHHCCEEEEECCCCCCCCCC---CCHHH-------HHCC
T ss_conf             7679997157886555214-26789986511114342121021123589964633378630---36455-------5567


Q ss_pred             CCCHHHHHHHHHCCC--CEECCCCCCCCHHHHHHHHHHCCCCEEEECCCCCC---------------------------C
Q ss_conf             400079999975587--52053055799789999985036980476468776---------------------------6
Q gi|254780229|r 1421 QTESILDALLPLFSM--RRLQWHYRSLNENLIACSNYYFYDNSLIVFPSPYT---------------------------S 1471 (1775)
Q Consensus      1421 ~~eSild~~~~~~p~--~~L~~HyRs~~e~lI~fSN~~fY~~~L~~~psp~~---------------------------~ 1471 (1775)
T Consensus       846 l~~SLFkrL~e~hpeaV~~Lt~QYR-Mn~~I~~LSN~L~Yg~~L~Cgs~eVs~~~~~~~~~~~~~~~~~s~s~~wl~~v~  924 (1100)
T KOG1805         846 LSESLFKRLSEKHPEAVSSLTLQYR-MNREIMRLSNKLIYGNRLKCGSKEVSRASELDRKGALSVYMDDSSSDHWLQAVL  924 (1100)
T ss_pred             CCHHHHHHHHHHCCHHHHHHHHHHH-HCCHHHHHHHHHEECCEEEECCHHHHHHHCCCCCHHHHHHCCCCCCHHHHHHHH
T ss_conf             3459999986509417776888876-321687640563688764556714422221464034544314442248999750


Q ss_pred             CCCCCEEEEECCCC--CC---C--CCCCHHHHHHHHHHHHHHHHC-CCCCEEEEEECCHHHHHHHHHHHHHHHHCCHHHH
Q ss_conf             66688489972897--21---7--888989999999999999531-8577189981998999999999999931297689
Q gi|254780229|r 1472 VDRYGVGFTHVKNG--VV---V--DQGNPEEARVIALAVKDHALR-YPEESLGVIAMNAKQRDLIESTINKLCRKDSEVE 1543 (1775)
Q Consensus      1472 ~~~~~v~~~~v~~g--~~---~--~~~N~~EA~~vv~~v~~~~~~-~~~~siGVvt~~~~Q~~~I~~~l~~~~~~~~~~~ 1543 (1775)
T Consensus       925 ~p~~~v~f~~~D~~~~ie~~~e~~~i~N~~EA~li~~~~~~fv~sGv~~~dIGIis~YraQv~Li~~~l~~~----~---  997 (1100)
T KOG1805         925 EPTRDVCFVNTDTCSTIESQGEKGGITNHGEAKLISELVEDFVKSGVKPSDIGIISPYRAQVELIRKILSSA----V---  997 (1100)
T ss_pred             CCCCCCEEEECCCCCCHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCCHHHEEEEEHHHHHHHHHHHHCCCC----C---
T ss_conf             678661688447654223321135767616789999999999982997888026516788999998660366----2---


Q ss_pred             HHHHHHCCCCCCEEECCHHHCCCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCEEEEEECCC
Q ss_conf             997641147898585425680866678899996650788887620011477765624689999983214269887038
Q gi|254780229|r 1544 KAISKLRMHADPFFIKNLENVQGDERDRIFISFTYGPHEPGGRVFQRFGPINSDIGWRRLNVLFTRSRRRIEVFSTMR 1621 (1775)
Q Consensus      1544 ~~~~~~~~~~e~~fvknle~vQGdERDvI~~S~~yg~~~~~g~~~~~fGpln~~gg~rRlNVa~sRAr~~~~v~~s~~ 1621 (1775)
T Consensus       998 ------------lEinTVD~yQGRDKd~IivSfvrs--n~~~~----~~eLL--kD~rRlNVAlTRAK~KLIlvGs~s 1055 (1100)
T KOG1805         998 ------------LEINTVDRYQGRDKDCIIVSFVRS--NKKSK----VGELL--KDWRRLNVALTRAKKKLILVGSKS 1055 (1100)
T ss_pred             ------------EEEEEHHHHCCCCCCEEEEEEEEC--CCCCC----HHHHH--HHHHHHHHHHHHHHCEEEEEECCC
T ss_conf             ------------455302432377787799999714--88662----77787--766777889876304089993311