HHsearch alignment for GI: 254780229 and conserved domain: PRK05595

>PRK05595 replicative DNA helicase; Provisional.
Probab=95.75  E-value=0.036  Score=37.61  Aligned_cols=55  Identities=22%  Similarity=0.335  Sum_probs=45.6

Q ss_pred             HHCCCCEEEECCCCCCCHHHHHHHHHH-HHHCCCEEEEEECCHHHHHHHHHHHHHC
Q ss_conf             514895599428787703899999999-9967982899601058999999864435
Q gi|254780229|r  416 VINGKNLIIEGPPGTGKSQTITNIIAA-AMLHGKKILFCAQKMAAIEVVRHRLEKA  470 (1775)
Q Consensus       416 ~~~g~~~vi~GPPGTGKSQTIaNlIa~-~la~Gk~VLfVaeK~aALdVV~~RL~~~  470 (1775)
T Consensus       198 l~~GdLiiiaaRP~mGKTa~alnia~~~a~~~g~~V~~fSlEMs~~ql~~R~ls~~  253 (444)
T PRK05595        198 FQKGDMILIAARPSMGKTTFALNIAEYAALREGKSVVIFSLEMSKEQLAYKLLCSE  253 (444)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHH
T ss_conf             98577799985798980799999999999866993799958899999999999964