HHsearch alignment for GI: 254780229 and conserved domain: PRK08939

>PRK08939 primosomal protein DnaI; Reviewed.
Probab=96.92  E-value=0.003  Score=48.87  Aligned_cols=36  Identities=25%  Similarity=0.320  Sum_probs=31.8

Q ss_pred             CCCCEEEECCCCCCCHHHHHHHHHHHHH-CCCEEEEEE
Q ss_conf             4895599428787703899999999996-798289960
Q gi|254780229|r  418 NGKNLIIEGPPGTGKSQTITNIIAAAML-HGKKILFCA  454 (1775)
Q Consensus       418 ~g~~~vi~GPPGTGKSQTIaNlIa~~la-~Gk~VLfVa  454 (1775)
T Consensus       156 ~~kGlyl~G~~G~GKT-yL~~aian~La~~g~~v~~v~  192 (306)
T PRK08939        156 KVKGLYLYGDFGVGKT-YLLAAIANELAKKGVSSTLVH  192 (306)
T ss_pred             CCCEEEEECCCCCCHH-HHHHHHHHHHHHCCCEEEEEE
T ss_conf             8877889899999899-999999999998699299987