HHsearch alignment for GI: 254780229 and conserved domain: PRK09473

>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional.
Probab=94.35  E-value=0.13  Score=31.61  Aligned_cols=41  Identities=22%  Similarity=0.326  Sum_probs=33.1

Q ss_pred             HHHHCCCCEEEECCCCCCCHHHHHHHHHHHHHCC----CEEEEEEC
Q ss_conf             9851489559942878770389999999999679----82899601
Q gi|254780229|r  414 IDVINGKNLIIEGPPGTGKSQTITNIIAAAMLHG----KKILFCAQ  455 (1775)
Q Consensus       414 ~~~~~g~~~vi~GPPGTGKSQTIaNlIa~~la~G----k~VLfVae  455 (1775)
T Consensus        37 f~i~~GEilgivGeSGsGKS-Tl~~~i~gll~~~~~~sG~I~~~G~   81 (330)
T PRK09473         37 FSLRAGETLGIVGESGSGKS-QTAFALMGLLAANGRIGGSATFNGR   81 (330)
T ss_pred             EEECCCCEEEEECCCCCHHH-HHHHHHHCCCCCCCCEEEEEEECCE
T ss_conf             68889989999868987799-9999997688888833589999999