HHsearch alignment for GI: 254780229 and conserved domain: PRK11650

>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional.
Probab=94.13  E-value=0.033  Score=37.90  Aligned_cols=39  Identities=31%  Similarity=0.532  Sum_probs=23.7

Q ss_pred             HHHCCCCEEEECCCCCCCHHHHHHHHHHHHHC-CCEEEEEE
Q ss_conf             85148955994287877038999999999967-98289960
Q gi|254780229|r  415 DVINGKNLIIEGPPGTGKSQTITNIIAAAMLH-GKKILFCA  454 (1775)
Q Consensus       415 ~~~~g~~~vi~GPPGTGKSQTIaNlIa~~la~-Gk~VLfVa  454 (1775)
T Consensus        26 ~i~~Ge~~~llGpsG~GKT-Tllr~iaGl~~p~~G~I~~~g   65 (358)
T PRK11650         26 DVADGEFIVLVGPSGCGKS-TLLRMVAGLERITSGEIWIGG   65 (358)
T ss_pred             EECCCCEEEEECCCCCHHH-HHHHHHHCCCCCCCEEEEECC
T ss_conf             9889989999999863699-999999769998862999999