>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.

Probab=97.09 E-value=0.0026 Score=49.47 Aligned_cols=52 Identities=33% Similarity=0.450 Sum_probs=43.6 Q ss_pred EEEECCCCCCCHHHHHHHHHHHHHCCCEEEEEE---CCHHHHHHHHHHHHHCCCC Q ss_conf 599428787703899999999996798289960---1058999999864435844 Q gi|254780229|r 422 LIIEGPPGTGKSQTITNIIAAAMLHGKKILFCA---QKMAAIEVVRHRLEKAGLG 473 (1775) Q Consensus 422 ~vi~GPPGTGKSQTIaNlIa~~la~Gk~VLfVa---eK~aALdVV~~RL~~~gLg 473 (1775) T Consensus 3 i~lvGptGvGKTTTiaKLA~~~~~~~~kV~lit~Dt~R~gA~eQL~~~a~~l~v~ 57 (173) T cd03115 3 ILLVGLQGVGKTTTAAKLALYLKKKGKKVLLVAADTYRPAAIEQLRVLGEQVGVP 57 (173) T ss_pred EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHCCCE T ss_conf 9998999998899999999999976992899974887577999999999974985

HHsearch alignment for GI: 254780229 and conserved domain: cd03115