HHsearch alignment for GI: 254780229 and conserved domain: cd03249

>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
Probab=95.07  E-value=0.016  Score=41.19  Aligned_cols=44  Identities=23%  Similarity=0.377  Sum_probs=32.8

Q ss_pred             HHHCCCCEEEECCCCCCCHHHHHHHHHHHHHC-CCEEEEEECCHHH
Q ss_conf             85148955994287877038999999999967-9828996010589
Q gi|254780229|r  415 DVINGKNLIIEGPPGTGKSQTITNIIAAAMLH-GKKILFCAQKMAA  459 (1775)
Q Consensus       415 ~~~~g~~~vi~GPPGTGKSQTIaNlIa~~la~-Gk~VLfVaeK~aA  459 (1775)
T Consensus        25 ~i~~G~~iaIvG~sGsGKS-TLl~ll~gl~~p~~G~I~idg~~i~~   69 (238)
T cd03249          25 TIPPGKTVALVGSSGCGKS-TVVSLLERFYDPTSGEILLDGVDIRD   69 (238)
T ss_pred             EECCCCEEEEECCCCCCHH-HHHHHHHHCCCCCCCEEEECCEECCC
T ss_conf             9769999999999999899-99999823861885189999999231