RPSBLAST alignment for GI: 254780229 and conserved domain: KOG1802

>gnl|CDD|37013 KOG1802, KOG1802, KOG1802, RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification]. Length = 935
 Score = 53.5 bits (128), Expect = 6e-07
 Identities = 36/173 (20%), Positives = 61/173 (35%), Gaps = 41/173 (23%)

Query: 379 ASSNQNIEYKI------DEIEDIHQRCPL--------IDDSDSSQHSAVIDVINGKNLII 424
           A   + +   +        +ED   +  L        +   ++SQ +AV  V+     +I
Sbjct: 371 AVDEKKVSGYLYHKLLGHPVEDSSLKKLLPRRFSVPNLPKLNASQSNAVKHVLQRPLSLI 430

Query: 425 EGPPGTGKSQTITNII-AAAMLHGKKILFCAQKMAAIEVVRHRLEKAGLG---------- 473
           +GPPGTGK+ T   I+   A  H   +L CA    A++ +  ++ K GL           
Sbjct: 431 QGPPGTGKTVTSATIVYHLARQHAGPVLVCAPSNIAVDQLAEKIHKTGLKVVRLCAKSRE 490

Query: 474 ------EFCLELHSHKVHKRAILDDLRKRIDNRNIKTVPQEIDVEITRYEELK 520
                  F       +   +  L  L K  D             E++  +E K
Sbjct: 491 DIESDVSFLSLHEQLRNMDKPELQKLLKLKDEGG----------ELSSSDEKK 533