RPSBLAST alignment for GI: 254780229 and conserved domain: KOG1803

>gnl|CDD|37014 KOG1803, KOG1803, KOG1803, DNA helicase [Replication, recombination and repair]. Length = 649
 Score = 60.8 bits (147), Expect = 4e-09
 Identities = 41/132 (31%), Positives = 67/132 (50%), Gaps = 4/132 (3%)

Query: 393 EDIHQRCPLIDDSDSSQHSAVIDVINGKNL-IIEGPPGTGKSQTITNIIAAAMLHGKKIL 451
            +I +      + +SSQ +AV   IN K+L II GPPGTGK++T+  II+  +   K++L
Sbjct: 174 IEIKKITFFNKNLNSSQKAAVSFAINNKDLLIIHGPPGTGKTRTLVEIISQLVKQKKRVL 233

Query: 452 FCAQKMAAIEVVRHRLEKAGLGEFCLELHSHKVHKRAI--LDDLRKRIDN-RNIKTVPQE 508
            CA    A++ +  RL    L    +   +  +   A   LD L    DN +N K + ++
Sbjct: 234 VCAPSNVAVDNIVERLTHLKLNLVRVGHPARLLESVADHSLDLLSNTKDNSQNAKDISKD 293

Query: 509 IDVEITRYEELK 520
           ID+   +  + K
Sbjct: 294 IDILFQKNTKTK 305