RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780230|ref|YP_003064643.1| hypothetical protein CLIBASIA_00575 [Candidatus Liberibacter asiaticus str. psy62] (96 letters) >gnl|CDD|145464 pfam02325, YGGT, YGGT family. This family consists of a repeat found in conserved hypothetical integral membrane proteins. The function of this region and the proteins which possess it is unknown. Length = 75 Score = 33.6 bits (78), Expect = 0.013 Identities = 32/87 (36%), Positives = 44/87 (50%), Gaps = 12/87 (13%) Query: 8 LLLLLELYANIVITRIVFSFLYTYDIINPLNFFVQTARQLLYSFTEPFLIPIRRFTPSLG 67 L LL +Y ++I R++ S++ D NP+ Q LY TEP L P RR P +G Sbjct: 1 LSTLLNIYIFLLIIRVILSWVPA-DPYNPI-------VQFLYRLTEPLLRPFRRVIPPIG 52 Query: 68 VEWKRIDLSPIILLTVIYILQCFLKFL 94 IDLSPI+ ++ LQ L L Sbjct: 53 ----GIDLSPIVAFLLLQFLQILLLGL 75 >gnl|CDD|37269 KOG2058, KOG2058, KOG2058, Ypt/Rab GTPase activating protein [Intracellular trafficking, secretion, and vesicular transport]. Length = 436 Score = 26.6 bits (58), Expect = 1.7 Identities = 24/102 (23%), Positives = 40/102 (39%), Gaps = 12/102 (11%) Query: 1 MNFLFKILLLLL--ELYANIVITRIVFSFLYTYDIINPLNFFVQTARQLLYSFTEPFLIP 58 MNFL +LLLL+ E A ++ ++ ++L Y N + Q +++L L Sbjct: 246 MNFLAALLLLLMPSEEDAFWMLVALIENYLPRYYTPNLIG--SQVDQKVLRELLREKLPK 303 Query: 59 IRRFTPSLGVEWKRIDLSPIILL--------TVIYILQCFLK 92 + GV+ L + L TV+ I C Sbjct: 304 LSLHLEGNGVDASLETLPWFLTLFVDILPSETVLRIWDCLFY 345 >gnl|CDD|114268 pfam05537, DUF759, Borrelia burgdorferi protein of unknown function (DUF759). This family consists of several uncharacterized proteins from the Lyme disease spirochete Borrelia burgdorferi. Length = 439 Score = 26.2 bits (57), Expect = 2.0 Identities = 13/49 (26%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Query: 7 ILLLLLELYANIV--ITRIVFSFLYTYDIINPLNFFVQTARQLLYSFTE 53 +L L+ + N + + + +F + DIINP+ +++A LY F + Sbjct: 359 VLDPLINIINNGIAKVKDFIGNFDFLKDIINPIGNGIKSAFNGLYFFAK 407 >gnl|CDD|38820 KOG3614, KOG3614, KOG3614, Ca2+/Mg2+-permeable cation channels (LTRPC family) [Inorganic ion transport and metabolism, Signal transduction mechanisms]. Length = 1381 Score = 25.3 bits (55), Expect = 3.8 Identities = 19/88 (21%), Positives = 33/88 (37%), Gaps = 19/88 (21%) Query: 19 VITRIVFSFLYTYDIINPL----------------NFFVQTARQLLYSFTEPFLIPIRRF 62 V++ I F L+TY ++ F++ RQ+ S + +R + Sbjct: 799 VLSYIAFLLLFTYVLLVDFQPSPSMWEWILFAWIFTLFLEEVRQIFISESGLLPQKVRVY 858 Query: 63 TPSLGVEWKRIDLSPIILLTVIYILQCF 90 W IDL I+L V +L+ Sbjct: 859 ---FADFWNLIDLLAILLFLVGPVLRLL 883 >gnl|CDD|39826 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism, Posttranslational modification, protein turnover, chaperones, Signal transduction mechanisms]. Length = 966 Score = 24.6 bits (53), Expect = 6.7 Identities = 8/22 (36%), Positives = 11/22 (50%) Query: 59 IRRFTPSLGVEWKRIDLSPIIL 80 R + LG+E RI SP+ Sbjct: 804 FRTYAEQLGLEPDRIIFSPVAA 825 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.340 0.155 0.469 Gapped Lambda K H 0.267 0.0534 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,284,827 Number of extensions: 67132 Number of successful extensions: 290 Number of sequences better than 10.0: 1 Number of HSP's gapped: 287 Number of HSP's successfully gapped: 32 Length of query: 96 Length of database: 6,263,737 Length adjustment: 64 Effective length of query: 32 Effective length of database: 4,880,761 Effective search space: 156184352 Effective search space used: 156184352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 51 (23.9 bits)