RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780230|ref|YP_003064643.1| hypothetical protein CLIBASIA_00575 [Candidatus Liberibacter asiaticus str. psy62] (96 letters) >gnl|CDD|173168 PRK14705, PRK14705, glycogen branching enzyme; Provisional. Length = 1224 Score = 27.7 bits (61), Expect = 0.74 Identities = 9/13 (69%), Positives = 12/13 (92%) Query: 47 LLYSFTEPFLIPI 59 L+Y+FTE FL+PI Sbjct: 1010 LVYAFTENFLLPI 1022 >gnl|CDD|178149 PLN02534, PLN02534, UDP-glycosyltransferase. Length = 491 Score = 26.4 bits (58), Expect = 1.8 Identities = 12/39 (30%), Positives = 22/39 (56%) Query: 20 ITRIVFSFLYTYDIINPLNFFVQTARQLLYSFTEPFLIP 58 I RIVF + + +++ N + A + S +EPF++P Sbjct: 141 IPRIVFHGMCCFSLLSSHNIRLHNAHLSVSSDSEPFVVP 179 >gnl|CDD|163563 TIGR03851, chitin_NgcE, carbohydrate ABC transporter, N-acetylglucosamine/diacetylchitobiose-binding protein. Members of this protein family are the substrate-binding protein, a lipid-anchored protein of Gram-positive bacteria in all examples found so far, that include NgcE of the chitin-degrader, Streptomyces olivaceoviridis, and close homologs from other species likely to share the same function. NgcE binds both N-acetylglucosamine and the chitin dimer, N,N'-diacetylchitobiose. Length = 450 Score = 26.2 bits (58), Expect = 1.9 Identities = 11/25 (44%), Positives = 17/25 (68%) Query: 52 TEPFLIPIRRFTPSLGVEWKRIDLS 76 EPF++P + P+ G+E+ RI LS Sbjct: 329 GEPFIVPAKAKNPAGGLEYLRIMLS 353 >gnl|CDD|165031 PHA02651, PHA02651, IL-1 receptor antagonist; Provisional. Length = 165 Score = 24.6 bits (53), Expect = 5.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 6 KILLLLLELYANIVITRIVFSFLYTYDIINPLNFFVQ 42 K L+LLL LY NI ++ F+Y +N F+++ Sbjct: 2 KKLILLLVLYINIFNSKAAGMFMYNIWDVNQKIFYLR 38 >gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1. This model represents the full length, over a thousand amino acids, of a multicopy family of eukaryotic proteins, many of which are designated ubiquitin-activating enzyme E1. Members have two copies of the ThiF family domain (pfam00899), a repeat found in ubiquitin-activating proteins (pfam02134), and other regions. Length = 1008 Score = 24.1 bits (52), Expect = 8.5 Identities = 9/35 (25%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Query: 31 YDIINPLNFFVQTARQLLYSFTEPFLIPIRRFTPS 65 +D+ PL+ A LY+ + IP S Sbjct: 706 FDLNEPLHLSFIQAAAKLYATV--YGIPFAEEDLS 738 >gnl|CDD|178286 PLN02682, PLN02682, pectinesterase family protein. Length = 369 Score = 24.0 bits (52), Expect = 8.6 Identities = 7/16 (43%), Positives = 12/16 (75%) Query: 21 TRIVFSFLYTYDIINP 36 +R+VF++ Y +II P Sbjct: 293 SRVVFAYTYMDNIIIP 308 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.340 0.155 0.469 Gapped Lambda K H 0.267 0.0682 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,645,384 Number of extensions: 98240 Number of successful extensions: 324 Number of sequences better than 10.0: 1 Number of HSP's gapped: 323 Number of HSP's successfully gapped: 26 Length of query: 96 Length of database: 5,994,473 Length adjustment: 64 Effective length of query: 32 Effective length of database: 4,611,561 Effective search space: 147569952 Effective search space used: 147569952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 50 (23.1 bits)