RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780230|ref|YP_003064643.1| hypothetical protein CLIBASIA_00575 [Candidatus Liberibacter asiaticus str. psy62] (96 letters) >1oih_A Putative alkylsulfatase ATSK; non-heme Fe(II) alphaketoglutarate dependent dioxygenase, jelly roll, oxidoreductase; 1.89A {Pseudomonas putida} SCOP: b.82.2.5 PDB: 1oii_A* 1oij_B* 1vz4_A 1vz5_A 1oik_A* 1oij_A* 1oij_C* Length = 301 Score = 25.2 bits (54), Expect = 3.5 Identities = 7/41 (17%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Query: 57 IPIRRFTPSLGVEWKRIDLS-PIILLTVIYILQCFLKFLIL 96 + + +G E + + LS + TV I ++ ++ Sbjct: 15 LDVHPVAGRIGAEIRGVKLSPDLDAATVEAIQAALVRHKVI 55 >1otj_A Alpha-ketoglutarate-dependent taurine dioxygenase; jelly roll motif, alpha ketoglutarate-dependent dioxygenase, oxidoreductase; 1.90A {Escherichia coli} SCOP: b.82.2.5 PDB: 1gqw_A* 1os7_A* 1gy9_A Length = 283 Score = 24.8 bits (53), Expect = 5.1 Identities = 7/41 (17%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Query: 57 IPIRRFTPSLGVEWKRIDLS-PIILLTVIYILQCFLKFLIL 96 + I P +G + DL+ P+ + L+ ++ Sbjct: 5 LSITPLGPYIGAQISGADLTRPLSDNQFEQLYHAVLRHQVV 45 >3cxn_A Urease accessory protein UREF; helical, nickel, chaperone; HET: MSE; 1.55A {Helicobacter pylori} PDB: 2wgl_A* Length = 274 Score = 24.2 bits (52), Expect = 6.5 Identities = 7/28 (25%), Positives = 11/28 (39%), Gaps = 1/28 (3%) Query: 43 TARQLLYSFTEPFLIPIRRFTPSLGVEW 70 L+ + PI +T S G+E Sbjct: 50 DNEFLILQVNDAVF-PIGSYTHSFGLET 76 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.340 0.155 0.469 Gapped Lambda K H 0.267 0.0518 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 853,353 Number of extensions: 35333 Number of successful extensions: 113 Number of sequences better than 10.0: 1 Number of HSP's gapped: 113 Number of HSP's successfully gapped: 6 Length of query: 96 Length of database: 5,693,230 Length adjustment: 62 Effective length of query: 34 Effective length of database: 4,190,102 Effective search space: 142463468 Effective search space used: 142463468 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 50 (23.5 bits)