HHsearch alignment for GI: 254780231 and conserved domain: COG1872

>COG1872 Uncharacterized conserved protein [Function unknown].
Probab=99.91  E-value=2.8e-24  Score=165.76  Aligned_cols=87  Identities=33%  Similarity=0.516  Sum_probs=79.8

Q ss_pred             EEEEEEEECCCCCCEEEEECCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCHHHEEEEECCCCCEEEEEECC
Q ss_conf             05999994186653023101456667776799999638767978899999999982998444799835577806999829
Q gi|254780231|r    2 CNVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLRMLSKQSSPLKIIYIDK   81 (98)
Q Consensus         2 ~~i~v~V~P~a~~~~I~g~~~~~d~~~~~~lkv~v~ApPv~GkAN~ali~~Lak~l~v~ks~I~I~~G~~sr~K~i~I~~   81 (98)
T Consensus        13 ~~l~V~V~P~a~~~~i~g~~-----~~~~~Lkv~i~apP~~GKAN~~li~~Lak~~~v~kS~V~ivsGetsR~K~v~i~~   87 (102)
T COG1872          13 VLLRVRVKPKAKRDSIVGLD-----EWRKRLKVRITAPPVDGKANEELIKFLAKTFGVPKSSVEIVSGETSRLKTVLIKN   87 (102)
T ss_pred             EEEEEEECCCCCCCCCCCEE-----CCCCEEEEEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCEEEEECC
T ss_conf             69999977788657533250-----6755599998469877613699999999995998541799846755530799548


Q ss_pred             -CHHHHHHHHHHH
Q ss_conf             -989999999752
Q gi|254780231|r   82 -DCKEITELLQNN   93 (98)
Q Consensus        82 -~~~~i~~~L~~~   93 (98)
T Consensus        88 i~~d~~~~~~~~~  100 (102)
T COG1872          88 IDPDQLPERLAAL  100 (102)
T ss_pred             CCHHHHHHHHHHH
T ss_conf             8989999998864