HHsearch alignment for GI: 254780231 and conserved domain: KOG3276

>KOG3276 consensus.
Probab=99.71  E-value=3.7e-17  Score=123.34  Aligned_cols=86  Identities=28%  Similarity=0.427  Sum_probs=76.6

Q ss_pred             EEEEEEEECCCCCCEEEEECCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCHHHEEEEECCCCCEEEEEECC
Q ss_conf             05999994186653023101456667776799999638767978899999999982998444799835577806999829
Q gi|254780231|r    2 CNVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLRMLSKQSSPLKIIYIDK   81 (98)
Q Consensus         2 ~~i~v~V~P~a~~~~I~g~~~~~d~~~~~~lkv~v~ApPv~GkAN~ali~~Lak~l~v~ks~I~I~~G~~sr~K~i~I~~   81 (98)
T Consensus        35 V~i~IhakpgaK~s~It~v~-------~e~V~V~IaApp~eGeANaeLl~ylskvLgLRksdv~ldkG~kSrsKvv~i~~  107 (125)
T KOG3276          35 VQIAIHAKPGAKQSAITDVG-------DEAVGVAIAAPPREGEANAELLEYLSKVLGLRKSDVTLDKGWKSRSKVVVIED  107 (125)
T ss_pred             EEEEEEECCCCCCCCEEECC-------CCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHEEECCCCCCCCEEEEEEC
T ss_conf             89999846874312255126-------43104577359766533699999999986012431365036565432899962


Q ss_pred             --CHHHHHHHHHHHH
Q ss_conf             --9899999997523
Q gi|254780231|r   82 --DCKEITELLQNND   94 (98)
Q Consensus        82 --~~~~i~~~L~~~~   94 (98)
T Consensus       108 ~~~~~e~i~~l~ak~  122 (125)
T KOG3276         108 LSATQEYIELLEAKV  122 (125)
T ss_pred             CCCCHHHHHHHHCCC
T ss_conf             744099999974458