HHsearch alignment for GI: 254780231 and conserved domain: PRK05090

>PRK05090 hypothetical protein; Validated.
Probab=99.91  E-value=2.7e-24  Score=165.79  Aligned_cols=74  Identities=24%  Similarity=0.345  Sum_probs=69.8

Q ss_pred             EEEEEEEECCCCCCEEEEECCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCHHHEEEEECCCCCEEEEEECC
Q ss_conf             05999994186653023101456667776799999638767978899999999982998444799835577806999829
Q gi|254780231|r    2 CNVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLRMLSKQSSPLKIIYIDK   81 (98)
Q Consensus         2 ~~i~v~V~P~a~~~~I~g~~~~~d~~~~~~lkv~v~ApPv~GkAN~ali~~Lak~l~v~ks~I~I~~G~~sr~K~i~I~~   81 (98)
T Consensus        11 ~~l~V~V~P~A~r~~i~g~~-------~~~Lkv~v~ApPvdGkAN~ali~~LA~~l~vpks~V~i~~G~tsR~K~i~I~~   83 (95)
T PRK05090         11 LVLRLYIQPKASRDQIVGLH-------GDELKVAITAPPVDGQANAHLVKFLAKQFKVAKSQVVIEKGELGRHKQVRIIN   83 (95)
T ss_pred             EEEEEEEEECCCCCEECCCC-------CCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCHHHEEEEECCCCCCEEEEEEC
T ss_conf             99999995288804580103-------99899999659978728999999999985997565899525876843999838


Q ss_pred             C
Q ss_conf             9
Q gi|254780231|r   82 D   82 (98)
Q Consensus        82 ~   82 (98)
T Consensus        84 p   84 (95)
T PRK05090         84 P   84 (95)
T ss_pred             C
T ss_conf             1