BLAST/PSIBLAST alignment of GI: 254780231 and GI: 209551279 at iteration 1
>gi|209551279|ref|YP_002283196.1| hypothetical protein Rleg2_3707 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 103
>gi|226705832|sp|B5ZTD4|Y3707_RHILW RecName: Full=UPF0235 protein Rleg2_3707 Length = 103
>gi|209537035|gb|ACI56970.1| protein of unknown function DUF167 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 103
 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 54/86 (62%), Gaps = 2/86 (2%)

Query: 6  VRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLR 65
          +RL PN  +  I   E   D     ++K +VT  P+KGKANKA++ ++AK L ++KSS+ 
Sbjct: 16 IRLTPNGGRDAIDGAET--DGEGEAYLKTRVTTVPEKGKANKALILLIAKSLGIAKSSVS 73

Query: 66 MLSKQSSPLKIIYIDKDCKEITELLQ 91
          ++S  ++  KI+ ID D +++ + L+
Sbjct: 74 LVSGDTARKKILRIDGDPEDLGKKLE 99