BLAST/PSIBLAST alignment of GI: 254780231 and GI: 325294029 at iteration 1
>gi|325294029|ref|YP_004279893.1| hypothetical protein AGROH133_08898 [Agrobacterium sp. H13-3] Length = 112
>gi|325061882|gb|ADY65573.1| hypothetical protein AGROH133_08898 [Agrobacterium sp. H13-3] Length = 112
 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 52/86 (60%), Gaps = 2/86 (2%)

Query: 6   VRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLR 65
           VRL PN  +  I  +E  +D     H+K +V+A P+ GKANKA++ +LAKK  L KS + 
Sbjct: 25  VRLTPNGGRDAIDGVE--QDADGNAHLKARVSAVPEGGKANKALVILLAKKFGLPKSPIT 82

Query: 66  MLSKQSSPLKIIYIDKDCKEITELLQ 91
            +S +++  KI+ ID D ++   L +
Sbjct: 83  FISGETARKKILRIDTDPEDFETLFR 108