RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780231|ref|YP_003064644.1| hypothetical protein CLIBASIA_00580 [Candidatus Liberibacter asiaticus str. psy62] (98 letters) >1n91_A ORF, hypothetical protein; alpha+beta, northeast structural genomics consortium, PSI, protein structure initiative, NESG; NMR {Escherichia coli O157} (A:) Length = 108 Score = 60.5 bits (147), Expect = 8e-11 Identities = 19/86 (22%), Positives = 36/86 (41%), Gaps = 7/86 (8%) Query: 6 VRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLR 65 + + P A + I L +K+ +TA P G+AN ++ L K+ ++KS + Sbjct: 19 LYIQPKASRDSIVGLHGD-------EVKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVV 71 Query: 66 MLSKQSSPLKIIYIDKDCKEITELLQ 91 + + K I I + E+ Sbjct: 72 IEKGELGRHKQIKIINPQQIPPEVAA 97 >1jrm_A MTH0637, conserved hypothetical protein MTH637; alpha-beta protein, structural genomics, OCSP, NESG; NMR {Methanothermobacterthermautotrophicus} (A:) Length = 104 Score = 55.9 bits (135), Expect = 2e-09 Identities = 20/92 (21%), Positives = 41/92 (44%), Gaps = 13/92 (14%) Query: 6 VRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKANKAMLAMLAKKLALSKSSLR 65 + + P + K GI S + +++K+ + PQKGKAN+ ++ ++ + Sbjct: 18 IEVSPASGKFGIPSYNEWRK-----RIEVKIHSPPQKGKANREIIKEFSETF---GRDVE 69 Query: 66 MLSKQSSPLKIIYIDKDCKE-----ITELLQN 92 ++S Q S K I I ++ ++E Sbjct: 70 IVSGQKSRQKTIRIQGMGRDLFLKLVSEKFGL 101 >2wzl_A Phosphoprotein; viral protein, rabies, virion, chaperone, RNA replication, nucleoprotein; 2.10A {Mokola virus} (A:) Length = 303 Score = 24.5 bits (53), Expect = 5.0 Identities = 9/25 (36%), Positives = 17/25 (68%) Query: 10 PNAKKSGIASLEIPKDTSDTIHMKI 34 P+ ++GI LE+ ++T+D I+ I Sbjct: 8 PSLIRAGIVELEMAEETTDLINRTI 32 >3ip4_B Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi protein complex, ligase, ATP-binding, nucleotide- binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_B 2dqn_B* 2g5h_B 2g5i_B* 2f2a_B (B:1-292) Length = 292 Score = 23.7 bits (51), Expect = 9.8 Identities = 6/28 (21%), Positives = 13/28 (46%) Query: 4 VIVRLIPNAKKSGIASLEIPKDTSDTIH 31 + + + K+ GI L + +D + H Sbjct: 105 IDIEVDGETKRIGITRLHMEEDAGKSTH 132 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.314 0.127 0.335 Gapped Lambda K H 0.267 0.0622 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 592,313 Number of extensions: 19909 Number of successful extensions: 51 Number of sequences better than 10.0: 1 Number of HSP's gapped: 48 Number of HSP's successfully gapped: 7 Length of query: 98 Length of database: 4,956,049 Length adjustment: 57 Effective length of query: 41 Effective length of database: 3,029,164 Effective search space: 124195724 Effective search space used: 124195724 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.3 bits)