RPSBLAST alignment of GI: 254780232 and protein with PDBid: 1e9g

>1e9g_A Ppase, inorganic pyrophosphatase; pyrophosphate phosphohydrolase, hydrolase, manganese; HET: PO4; 1.15A {Saccharomyces cerevisiae} SCOP: b.40.5.1 PDB: 1e6a_A* 1wgi_A 1wgj_A 2ihp_A* 8prk_A 2ik6_A 2ik2_A 2ik4_A 117e_A 2ik1_A* 2ik9_A 2ik0_A 2ik7_A 1m38_A 1ypp_A 1huk_A 1huj_A 1pyp_A Length = 286
 Score =  158 bits (400), Expect = 8e-40
 Identities = 46/196 (23%), Positives = 72/196 (36%), Gaps = 31/196 (15%)

Query: 7   ISLGSNSPIDV-NVFIEISLGGYPIKYEMDK-----------KSGVLVVDRFISTPMLYP 54
           I L ++   ++ N+ +EI       K E+ K           K G L   R       Y 
Sbjct: 32  IPLYADKENNIFNMVVEIPRWTN-AKLEITKEETLNPIIQDTKKGKLRFVRNCFPHHGYI 90

Query: 55  GNYGFIPNTLSD------------DGDPVDVIMYSSEPILPGSVISTRPIGVMKMEDDGG 102
            NYG  P T  D            D DP+DV+         G V   + +G+M + D+G 
Sbjct: 91  HNYGAFPQTWEDPNVSHPETKAVGDNDPIDVLEIGETIAYTGQVKQVKALGIMALLDEGE 150

Query: 103 IDEKILAVPSKN-ITSLYDSIQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEG-- 159
            D K++A+   + +    + I+  E      L+    +F+ YK  + GK      + G  
Sbjct: 151 TDWKVIAIDINDPLAPKLNDIEDVEKYFPGLLRATNEWFRIYKIPD-GKPENQFAFSGEA 209

Query: 160 --VNSAHKIILEAVKR 173
                A  II E    
Sbjct: 210 KNKKYALDIIKETHDS 225