BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780232|ref|YP_003064645.1| inorganic pyrophosphatase [Candidatus Liberibacter asiaticus str. psy62] (177 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780232|ref|YP_003064645.1| inorganic pyrophosphatase [Candidatus Liberibacter asiaticus str. psy62] Length = 177 Score = 356 bits (913), Expect = e-100, Method: Compositional matrix adjust. Identities = 177/177 (100%), Positives = 177/177 (100%) Query: 1 MVQLNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFI 60 MVQLNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFI Sbjct: 1 MVQLNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGFI 60 Query: 61 PNTLSDDGDPVDVIMYSSEPILPGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYD 120 PNTLSDDGDPVDVIMYSSEPILPGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYD Sbjct: 61 PNTLSDDGDPVDVIMYSSEPILPGSVISTRPIGVMKMEDDGGIDEKILAVPSKNITSLYD 120 Query: 121 SIQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNSAHKIILEAVKRGIKE 177 SIQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNSAHKIILEAVKRGIKE Sbjct: 121 SIQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNSAHKIILEAVKRGIKE 177 >gi|254780321|ref|YP_003064734.1| GTP-binding protein LepA [Candidatus Liberibacter asiaticus str. psy62] Length = 606 Score = 27.7 bits (60), Expect = 0.11, Method: Composition-based stats. Identities = 20/89 (22%), Positives = 36/89 (40%), Gaps = 14/89 (15%) Query: 23 ISLGGYPIKYEMDKKSGVLVVDRFISTPMLYPGNYGF------------IPNTLSDDGDP 70 I L G KY++++ ++ + I LYPG G + +T++DD P Sbjct: 232 IRLMGTNAKYQVERIG--ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSP 289 Query: 71 VDVIMYSSEPILPGSVISTRPIGVMKMED 99 + +PI P P+ + E+ Sbjct: 290 TTSALPGFKPIQPVVFCGLFPVDATQFEN 318 >gi|254781028|ref|YP_003065441.1| putative Mg2+ chelatase family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 87 Score = 23.5 bits (49), Expect = 2.2, Method: Compositional matrix adjust. Identities = 14/56 (25%), Positives = 26/56 (46%), Gaps = 10/56 (17%) Query: 91 PIGVMKMEDDGGIDEKILAVPSKNITSLYDSIQSY----------EDVPNAYLQKV 136 P+ V M G + +I+ +P K + + IQS+ ++P+ YLQ + Sbjct: 17 PVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQLI 72 >gi|254780682|ref|YP_003065095.1| hypothetical protein CLIBASIA_02845 [Candidatus Liberibacter asiaticus str. psy62] Length = 199 Score = 22.3 bits (46), Expect = 4.9, Method: Compositional matrix adjust. Identities = 11/42 (26%), Positives = 21/42 (50%) Query: 97 MEDDGGIDEKILAVPSKNITSLYDSIQSYEDVPNAYLQKVEH 138 ++ + + EK L P KNI +L D+ + N ++ + H Sbjct: 148 LKPNVCVKEKKLIPPRKNINNLKDTNHRLKIKNNQEIKNIHH 189 >gi|254780605|ref|YP_003065018.1| putative aminopeptidase [Candidatus Liberibacter asiaticus str. psy62] Length = 609 Score = 22.3 bits (46), Expect = 4.9, Method: Compositional matrix adjust. Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Query: 70 PVDVIMYSSEPILPGSVISTRPIGVMKMEDDGGIDEKILAV 110 P + + EP+LPG ++S P G + G E +L V Sbjct: 497 PQGISRTNQEPLLPGMILSNEP-GYYRCGAFGIRIENVLCV 536 >gi|254781172|ref|YP_003065585.1| NAD-dependent DNA ligase LigA [Candidatus Liberibacter asiaticus str. psy62] Length = 731 Score = 21.6 bits (44), Expect = 7.8, Method: Composition-based stats. Identities = 9/24 (37%), Positives = 14/24 (58%) Query: 105 EKILAVPSKNITSLYDSIQSYEDV 128 E IL ++T+LYDSI ++ Sbjct: 525 ENILGFGDVSVTNLYDSINKRRNI 548 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.315 0.138 0.403 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 123,992 Number of Sequences: 1233 Number of extensions: 5452 Number of successful extensions: 14 Number of sequences better than 100.0: 12 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 12 length of query: 177 length of database: 328,796 effective HSP length: 68 effective length of query: 109 effective length of database: 244,952 effective search space: 26699768 effective search space used: 26699768 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 35 (18.1 bits)