HHsearch alignment for GI: 254780233 and conserved domain: COG1217

>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms].
Probab=100.00  E-value=0  Score=1703.67  Aligned_cols=601  Identities=63%  Similarity=0.977  Sum_probs=590.9

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCEECCCCHHHHHCCCEEEEEEEEEEECCEEEEEECCCCCCCC
Q ss_conf             02431499985468987788999999839614232200000388577987096064679999989979999728987540
Q gi|254780233|r   16 YMQIRNIAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLEKERGITILAKVTSIVWNDVRINIVDTPGHADF   95 (624)
Q Consensus        16 ~~~IRNiaIiaHvDhGKTTL~d~LL~~sG~~~~~~~v~~~vmD~~~~EreRGITI~a~~~~~~~~~~~iNiiDTPGH~DF   95 (624)
T Consensus         2 ~~~iRNIAIIAHVDHGKTTLVD~LLkQSGtf~~~e~v~ERvMDSnDlEkERGITILaKnTav~~~~~~INIvDTPGHADF   81 (603)
T COG1217           2 MEDIRNIAIIAHVDHGKTTLVDALLKQSGTFREREEVAERVMDSNDLEKERGITILAKNTAVNYNGTRINIVDTPGHADF   81 (603)
T ss_pred             CCCCCEEEEEEEECCCCCHHHHHHHHHCCCCCCCCCHHHHHCCCCCHHHHCCCEEEECCCEEECCCEEEEEECCCCCCCC
T ss_conf             76653068999844881028999987316544565201440376423443493898515246208838987658986776


Q ss_pred             HHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCHHHCCHH
Q ss_conf             79999998742178999976878864789999999972997899997543667402568999998886226730110426
Q gi|254780233|r   96 GGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALKIGLRPIVVVNKVDRSDARADEVINEVFDLFSALDATDAQLDFP  175 (624)
Q Consensus        96 ~gEVer~l~~~DgaiLvVdA~eGv~~QT~~vl~~A~~~~l~~IvvINKiDr~~a~~~~v~~ei~dlf~~l~a~de~ld~P  175 (624)
T Consensus        82 GGEVERvl~MVDgvlLlVDA~EGpMPQTrFVlkKAl~~gL~PIVVvNKiDrp~Arp~~Vvd~vfDLf~~L~A~deQLdFP  161 (603)
T COG1217          82 GGEVERVLSMVDGVLLLVDASEGPMPQTRFVLKKALALGLKPIVVINKIDRPDARPDEVVDEVFDLFVELGATDEQLDFP  161 (603)
T ss_pred             CCHHHHHHHHCCEEEEEEECCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCHHHCCCE
T ss_conf             62545114323348999975558887314448999974998489996778999887899999999999819974557870


Q ss_pred             HHHHHHHCCEECCCCCCCCCCCCHHHHHHHHCCCCCCCCC-CCHHHCCCCCCCCCCCCCEEEEEEECCCCCCCCCEEEEE
Q ss_conf             6887886591646742233486413555321024542233-200000111101367773499999607805159889996
Q gi|254780233|r  176 ILYGSGRFGWMSDSSDGSRDQGMVPLLNLIVDHVPPPVIS-EGEFKMIGTILEKDPFLGRIVTGRIHSGTIKSNQNIKAL  254 (624)
Q Consensus       176 v~~~Sa~~G~~~~~~~~~~~~gl~~Lld~Ii~~iP~P~~~-e~pl~~~V~~i~~d~y~Gria~gRV~sGtlk~Gd~V~vl  254 (624)
T Consensus       162 ivYAS~~~G~a~~~~~~~~-~~m~pLfe~I~~hvp~P~~~~d~PlQ~qvt~Ldyn~y~GrIgigRi~~G~vk~~q~V~~i  240 (603)
T COG1217         162 IVYASARNGTASLDPEDEA-DDMAPLFETILDHVPAPKGDLDEPLQMQVTQLDYNSYVGRIGIGRIFRGTVKPNQQVALI  240 (603)
T ss_pred             EEEEECCCCEECCCCCCCC-CCHHHHHHHHHHHCCCCCCCCCCCEEEEEEEECCCCCCCEEEEEEEECCCCCCCCEEEEE
T ss_conf             7985414751015865555-531689999997589998999888078998522445452268999852725489768998


Q ss_pred             CCCCCCEEECCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCEEEEEECCCCCCC
Q ss_conf             05785012114553011036653444112545543222233210122110556521123366665421578612686554
Q gi|254780233|r  255 SPDGALVEVGRVSKILAFRGIDRQPIDEAHAGDIVSIAGLVKATVADTFCDPSIDEPLKAQPIDPPTVTMTFGVNDSPLA  334 (624)
Q Consensus       255 ~~~g~~~~~~kV~~L~~~~G~~r~~v~ea~AGDIvaIaGl~~~~iGDTL~~~~~p~~Lp~i~i~~Ptis~~f~vn~sP~a  334 (624)
T Consensus       241 ~~~g~-~~~gri~kll~f~GL~R~ei~eA~AGDIvaiaG~~~~~igdTi~d~~~~~aLp~l~iDePTlsMtf~vN~SPfA  319 (603)
T COG1217         241 KSDGT-TENGRITKLLGFLGLERIEIEEAEAGDIVAIAGLEDINIGDTICDPDNPEALPALSVDEPTLSMTFSVNDSPFA  319 (603)
T ss_pred             CCCCC-EEEEEEEEEEECCCEEEEEHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCC
T ss_conf             47994-77557766655054233350012556789982764355434135877766788733689846899995688777


Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCEEEEEECCHHHHHHHHHHHHHCCEEEECCCCEEEEEEECCEECCE
Q ss_conf             44432101788999999973028379999859997599996364568888741233480330157448998208826041
Q gi|254780233|r  335 GTEGDKVTSRMIRDRLFKEAEGNIALKIEESSSKDAFFVSGRGELQLAVLIETMRREGFELAVSRPRVVIKKEGDSLLEP  414 (624)
Q Consensus       335 g~eg~~~ts~~l~~rL~ke~~~dvsL~ve~~~~~~~~~v~GrGeLHL~IliE~mRREG~E~~vs~P~V~~k~~dg~~lEP  414 (624)
T Consensus       320 G~EGk~vTSR~i~dRL~~El~~NValrVe~t~~pd~f~VsGRGELhLsILiE~MRREGfEl~VsrP~Vi~keidG~~~EP  399 (603)
T COG1217         320 GKEGKFVTSRQIRDRLNKELETNVALRVEETESPDAFEVSGRGELHLSILIENMRREGFELQVSRPEVIIKEIDGVKCEP  399 (603)
T ss_pred             CCCCCEEEHHHHHHHHHHHHHHCEEEEEEECCCCCEEEEECCCEEEHHHHHHHHHHCCEEEEECCCEEEEEECCCCCCCC
T ss_conf             76785655899999999876416359987369997379805644457888887642341777258659999238846685


Q ss_pred             EEEEEEECCHHHHHHHHHHHHHCCCEECCCCCCCCCEEEEEEEECHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCC
Q ss_conf             68888731323310789988743540104213689849999996133565688998853276167888870530135787
Q gi|254780233|r  415 IEEVVIDVDEEHSGAVVQKMTLHKSEMIELRPSGTGRVRLVFLSPTRGLIGYQSQLMTDTRGTAIMNRLFHSYQPHKGEI  494 (624)
Q Consensus       415 ie~v~I~vp~ey~G~Vi~~l~~RrG~i~~m~~~~~g~~~l~~~vP~r~l~g~~~~l~s~T~G~g~~~~~f~~Y~p~~g~i  494 (624)
T Consensus       400 ~E~v~iDv~ee~~G~Vie~lg~RKgem~~M~~~g~G~~Rlef~iPaRGLIGfrteFlt~TrG~Gi~n~~F~~Y~p~~g~i  479 (603)
T COG1217         400 FEEVTIDVPEEHQGAVIEKLGERKGEMKDMAPDGKGRVRLEFVIPARGLIGFRTEFLTMTRGTGIMNHSFDHYRPVKGEI  479 (603)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCEECCCHHEEECCCCCEEEEECCCCCCCCCCCC
T ss_conf             01378637423201899987653576751535899859999972476501021110221456434321101345555654


Q ss_pred             CCCCCEEEEECCCCCEEEEHHHHHHHHCCEEECCCCEEECCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCC
Q ss_conf             87774258882898583003331232112262799854378286764675431034416650122136887326885599
Q gi|254780233|r  495 GGRSNGVLLSNEEGKVVAYALFNLEDRGSMIVEPGDKVYQGMIVGIHTRENDLDVNVLKGKKLTNMRASGKDEAVKLVPA  574 (624)
Q Consensus       495 ~~r~~G~lis~~~G~~~~yal~~lq~rG~~fv~pg~~vy~Gmivge~~r~~dl~vN~~k~k~ltn~r~~~~d~~~~l~~~  574 (624)
T Consensus       480 ~~R~nGvLiS~~~G~a~~yal~~lqdRG~~Fi~pG~~vYeGmiiG~hsR~nDL~VN~~k~K~LTN~Rasg~Dea~~L~~p  559 (603)
T COG1217         480 GGRHNGVLISNETGKAVAYALFNLQDRGKLFIEPGTKVYEGMIIGEHSRDNDLTVNVLKGKKLTNMRASGKDEAVTLTPP  559 (603)
T ss_pred             CCCCCCEEEECCCCCCHHHHHHHHHHCCCEEECCCCCEEEEEEEEEECCCCCCEECCCCCCCCCCCCCCCCCCCEEECCC
T ss_conf             55545159976898434765535875375664599726501698530675671342423442312104687622574484


Q ss_pred             CEEEHHHHHHHHHCCEEEEECCCCEEEEEECCCHHHHHHHHHHH
Q ss_conf             23339999888645839999887716763015965768888766
Q gi|254780233|r  575 VKMTLEQALSWIQNDELVEVTPKSIRLRKMYLDPNERKRKGKSV  618 (624)
Q Consensus       575 ~~~~le~~~~~i~~DelvevtP~~iR~RK~~l~~~~r~~~~k~~  618 (624)
T Consensus       560 ~~msLE~Ale~i~dDElvEVTP~sIRlRK~~L~~n~Rkr~~k~~  603 (603)
T COG1217         560 IRMTLERALEFIADDELVEVTPESIRLRKKILNENERKRAEKRK  603 (603)
T ss_pred             CCCCHHHHHHHCCCCCEEEECCHHEEHHHHHCCHHHHHHHHCCC
T ss_conf             10669999854587706996415702246656965654544069