HHsearch alignment for GI: 254780233 and conserved domain: TIGR03594

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=99.69  E-value=8.9e-16  Score=122.80  Aligned_cols=155  Identities=30%  Similarity=0.313  Sum_probs=113.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCEECCCCHHHHHCCCEEEEEEEEEEECCEEEEEECCCCCCC-----
Q ss_conf             149998546898778899999983961423220000038857798709606467999998997999972898754-----
Q gi|254780233|r   20 RNIAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLEKERGITILAKVTSIVWNDVRINIVDTPGHAD-----   94 (624)
Q Consensus        20 RNiaIiaHvDhGKTTL~d~LL~~sG~~~~~~~v~~~vmD~~~~EreRGITI~a~~~~~~~~~~~iNiiDTPGH~D-----   94 (624)
T Consensus       173 iriaivGrPNvGKSTl~N~ll~~~r~ivs~~---------------~GtTrD~i~~~~~~~~~~~~~iDTaGirkk~k~~  237 (429)
T TIGR03594       173 IKIAIIGRPNVGKSTLVNALLGEERVIVSDI---------------AGTTRDSIDIPFERNGKKYLLIDTAGIRRKGKVT  237 (429)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHCCCC---------------CCCCCCCEEEEEEECCEEEEEEECCCCCCCCCCC
T ss_conf             2699974887654677777654333214799---------------9863102687999999089999898876366423


Q ss_pred             ----C--HHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCC-CC-CHHHHHHHHHHHHHHCC
Q ss_conf             ----0--7999999874217899997687886478999999997299789999754366-74-02568999998886226
Q gi|254780233|r   95 ----F--GGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALKIGLRPIVVVNKVDRS-DA-RADEVINEVFDLFSALD  166 (624)
Q Consensus        95 ----F--~gEVer~l~~~DgaiLvVdA~eGv~~QT~~vl~~A~~~~l~~IvvINKiDr~-~a-~~~~v~~ei~dlf~~l~  166 (624)
T Consensus       238 ~~~e~~s~~~t~~~i~~~dvvil~iD~~~~~~~qD~~i~~~i~~~~k~~ii~~NK~Dli~~~~~~~~~~~~i~~~l~~~-  316 (429)
T TIGR03594       238 EGIEKYSVLRTLKAIERADVVLLVLDATEGITEQDLRIAGLALEAGKALIIVVNKWDLVKDEKTREEFKKELRRKLPFL-  316 (429)
T ss_pred             HHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEHHHCCCCHHHHHHHHHHHHHHCCCC-
T ss_conf             0477999999999987447799999766588488899999898739976999972230379999999999999856236-


Q ss_pred             CCHHHCCHHHHHHHHHCCEECCCCCCCCCCCCHHHHHHHH
Q ss_conf             7301104266887886591646742233486413555321
Q gi|254780233|r  167 ATDAQLDFPILYGSGRFGWMSDSSDGSRDQGMVPLLNLIV  206 (624)
Q Consensus       167 a~de~ld~Pv~~~Sa~~G~~~~~~~~~~~~gl~~Lld~Ii  206 (624)
T Consensus       317 -----~~~pI~fiSA~~g-----------~gi~kl~~~i~  340 (429)
T TIGR03594       317 -----DFAPIVFISALTG-----------QGVDKLLDAID  340 (429)
T ss_pred             -----CCCCEEEEECCCC-----------CCHHHHHHHHH
T ss_conf             -----8986899734577-----------89999999999