HHsearch alignment for GI: 254780233 and conserved domain: cd03221

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth. EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site. The reaction requires ATP hydrolysis. EF-3 contains two ATP nucleotide binding sequence (NBS) motifs. NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=92.56  E-value=0.8  Score=24.62  Aligned_cols=108  Identities=21%  Similarity=0.317  Sum_probs=57.9

Q ss_pred             CCCCCEEEEECCCCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCC-CCCCCCEECCCCHHHHHCCCEEEEEEEEEEEC
Q ss_conf             31340465313468024314999854689877889999998396142-32200000388577987096064679999989
Q gi|254780233|r    2 FYDDGLFFIYGRLGYMQIRNIAIIAHVDHGKTTLVDELLKQSGVFRD-NQRVSERVMDCNDLEKERGITILAKVTSIVWN   80 (624)
Q Consensus         2 ~~~~~~~~~~~~~~~~~IRNiaIiaHvDhGKTTL~d~LL~~sG~~~~-~~~v~~~vmD~~~~EreRGITI~a~~~~~~~~   80 (624)
T Consensus         9 ~y~~~~vl~~is~~i~~ge~~~l~G~NGsGKTTl~~~l---~G~~~~~~G~i-------------------------~~~   60 (144)
T cd03221           9 TYGGKLLLKDISLTINPGDRIGLVGRNGAGKSTLLKLI---AGELEPDEGIV-------------------------TWG   60 (144)
T ss_pred             EECCEEEEEEEEEEECCCCEEEEECCCCCCHHHHHHHH---HCCCCCCCEEE-------------------------EEC
T ss_conf             99999999634899879999999989998499999998---48988985099-------------------------999


Q ss_pred             C-EEEEEECCCCCCCC-HHHHHHHH----HHHCEEEEEEE-CCCCCCHHHHHHHHHHHHCCCCEEEEEE
Q ss_conf             9-79999728987540-79999998----74217899997-6878864789999999972997899997
Q gi|254780233|r   81 D-VRINIVDTPGHADF-GGEVERIL----CMVESVVVLVD-AAEGPMPQTKFVVGKALKIGLRPIVVVN  142 (624)
Q Consensus        81 ~-~~iNiiDTPGH~DF-~gEVer~l----~~~DgaiLvVd-A~eGv~~QT~~vl~~A~~~~l~~IvvIN  142 (624)
T Consensus        61 ~~~~i~y~~-----QLSgGqkqr~~la~al~~~p~iliLDEPt~~LD~~~~~~i~~~l~~~~~tii~vs  124 (144)
T cd03221          61 STVKIGYFE-----QLSGGEKMRLALAKLLLENPNLLLLDEPTNHLDLESIEALEEALKEYPGTVILVS  124 (144)
T ss_pred             CCCEEEEEH-----HCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             960899870-----0799999999999997259989999577555899999999999997099999996