HHsearch alignment for GI: 254780234 and conserved domain: KOG0571

>KOG0571 consensus.
Probab=96.50  E-value=0.05  Score=34.86  Aligned_cols=113  Identities=19%  Similarity=0.225  Sum_probs=67.5

Q ss_pred             EEEEEECCCHHHHHHHHHH----HH---HCCCEEEEEEEECCCCCHHHHHHHHHHHCCCEEEEEECHHHHHHHHHHHHHH
Q ss_conf             8999914772599999999----87---1898699999457871106899999997398079982008999998799997
Q gi|254780234|r    7 KVVLAYSGGLDTSIILKWL----QV---EKGLEVIVFIADLGQGEELKIASDKARLLGAKEVYVKDLRREFVRDFVFPMF   79 (404)
Q Consensus         7 kVvlaySGGLDTSv~i~~L----~~---e~g~eVi~~~~d~Gq~~d~~~~~~~A~~~Ga~~~~v~D~r~ef~~~~i~~~I   79 (404)
T Consensus       227 p~GvLLSGGLDSSLvAsia~R~lk~~~~~~~~~lhsFaIGle~SPDL~aarkVAd~igt~Hhe~~ft~qeg-idal~eVI  305 (543)
T KOG0571         227 PFGVLLSGGLDSSLVASIAARELKKAQAARGSKLHSFAIGLEDSPDLLAARKVADFIGTIHHEHTFTIQEG-IDALDEVI  305 (543)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEECHHHH-HHHHHHHH
T ss_conf             61589507731899999999999876641278754788528998537888999987488523899758887-77888774


Q ss_pred             HCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEECHHHCCCCHHH
Q ss_conf             3686547874201301243359999999885689287500111682156
Q gi|254780234|r   80 RANALYEGYYLLGTAIARPLIAKYLVDIANETGADAIAHGSTGKGNDQV  128 (404)
Q Consensus        80 ~ana~Yeg~Ypl~tslaRplia~~lv~~a~~~ga~~iaHG~TgkGNDQv  128 (404)
T Consensus       306 ~hLETYDvtt-IRastpmyLl----sr~Ikk~gvkmvlS---GEGsDEi  346 (543)
T KOG0571         306 YHLETYDVTT-IRASTPMYLL----SRKIKKLGVKMVLS---GEGSDEI  346 (543)
T ss_pred             EEEECCCCCE-EECCCCHHHH----HHHHHHCCEEEEEE---CCCCHHH
T ss_conf             2410134415-8617746789----99997655289981---5771344