HHsearch results for GI: 254780234 and protein with PDBid: 2hma_A

>2hma_A Probable tRNA (5-methylaminomethyl-2- thiouridylate)-methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae}
Probab=99.75  E-value=2.9e-17  Score=142.60  Aligned_cols=168  Identities=24%  Similarity=0.342  Sum_probs=122.4

Q ss_pred             CCC-CCCEEEEEECCCHHHHHHHHHHHHHCCCEEEEEEEECCC----------CCHHHHHHHHHHHCCCEEEEEECHHHH
Q ss_conf             987-777899991477259999999987189869999945787----------110689999999739807998200899
Q gi|254780234|r    1 MSR-DVKKVVLAYSGGLDTSIILKWLQVEKGLEVIVFIADLGQ----------GEELKIASDKARLLGAKEVYVKDLRRE   69 (404)
Q Consensus         1 M~~-~~kkVvlaySGGLDTSv~i~~L~~e~g~eVi~~~~d~Gq----------~~d~~~~~~~A~~~Ga~~~~v~D~r~e   69 (404)
                      |+. +++||++|+|||+||||++.+|+ ++||||+++++.++.          .+|+.++++.|..+|+ +++++|++++
T Consensus         4 m~~~~k~rV~v~mSGGVDSsvaA~LL~-~~G~~V~gv~m~~~~~~~~~~~c~~~~d~~da~~va~~LgI-p~~~~d~~~~   81 (376)
T 2hma_A            4 MSDNSKTRVVVGMSGGVDSSVTALLLK-EQGYDVIGIFMKNWDDTDENGVCTATEDYKDVVAVADQIGI-PYYSVNFEKE   81 (376)
T ss_dssp             -CCGGGSEEEEECCSSHHHHHHHHHHH-HTTCEEEEEEEECCCCCC----CHHHHHHHHHHHHHHHHTC-CEEEEECHHH
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHH-HCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCC-CEEEECHHHH
T ss_conf             777876889999268799999999999-77995799999787787777877837889999999998599-8899650899


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCH-HHHHHHHHHHHHHHHCCCCEEECHH--------HC---------CCCHHHHHH
Q ss_conf             99987999973686547874201301-2433599999998856892875001--------11---------682156799
Q gi|254780234|r   70 FVRDFVFPMFRANALYEGYYLLGTAI-ARPLIAKYLVDIANETGADAIAHGS--------TG---------KGNDQVRFE  131 (404)
Q Consensus        70 f~~~~i~~~I~ana~Yeg~Ypl~tsl-aRplia~~lv~~a~~~ga~~iaHG~--------Tg---------kGNDQvRFe  131 (404)
                      |.++.+-|.+..  .-.|+.|+-.-+ -|.+--..+++.|++.|++.||.|-        +|         ...||--| 
T Consensus        82 f~~~V~~~f~~~--y~~G~TPNPcv~CN~~IKF~~l~~~a~~~g~d~iATGHYAri~~~~~g~~~L~r~~D~~KDQSYf-  158 (376)
T 2hma_A           82 YWDRVFEYFLAE--YRAGRTPNPDVMCNKEIKFKAFLDYAITLGADYVATGHYARVARDEDGTVHMLRGVDNGKDQTYF-  158 (376)
T ss_dssp             HHHHTHHHHHHH--HHTTCCCCHHHHHHHHTTTTHHHHHHHTTTCSEEECCCSEEEEECSSSCEEEEECSSTTTCCGGG-
T ss_pred             HHHHHHHHHHHH--HHCCCCCCCCHHHCHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCEEEEECCCCCCCCCEE-
T ss_conf             999998989999--86037999442112346699999999861566214673421367799868988516777774224-


Q ss_pred             HHHHHHCCC--CEEEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCH
Q ss_conf             999985879--7077441006876379999999970896756656788641572
Q gi|254780234|r  132 LSAYSLNSD--IEIIAPWRHWSFKGRQDLIDFAEKHAIPIDKNKRGEAPFSIDT  183 (404)
Q Consensus       132 ~~~~~l~P~--l~viaP~Rd~~~~sRe~~i~ya~~~gIpv~~~~~~~~~yS~D~  183 (404)
                        ...|.++  -+++=|.-+  ++ .+|--+.|+++|+|+..     +|=|.|-
T Consensus       159 --L~~l~~~~L~~~iFPLG~--~~-K~eVR~iA~~~gl~~a~-----K~dSq~I  202 (376)
T 2hma_A          159 --LSQLSQEQLQKTMFPLGH--LE-KPEVRRLAEEAGLSTAK-----KKDSTGI  202 (376)
T ss_dssp             --GTTCCHHHHTTEECTTTT--CC-HHHHHHHHHHTTCTTTT-----CCCCCSC
T ss_pred             --EEEECHHHHHCCCCCCCC--CC-HHHHHHHHHHCCCCCCC-----CCCCCCC
T ss_conf             --443258788366688899--97-78999999875953267-----6455453