Query         gi|254780235|ref|YP_003064648.1| hypothetical protein CLIBASIA_00600 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 74
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 39220
Date          Mon May 23 23:53:14 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780235.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 pfam04663 Phenol_monoox Phenol  38.1      15 0.00038   18.2   1.1   14   24-37     13-26  (67)
  2 pfam10828 DUF2570 Protein of u  34.3      23  0.0006   17.2   1.6   23   45-67      5-27  (110)
  3 pfam04272 Phospholamban Phosph  24.4      64  0.0016   14.9   3.4   23   38-60     28-51  (52)
  4 KOG4703 consensus               24.3     1.2 3.1E-05   23.9  -6.4   62    8-69     14-84  (431)
  5 pfam10856 DUF2678 Protein of u  22.4      50  0.0013   15.4   1.6   28   38-66     86-113 (114)
  6 pfam10790 DUF2604 Protein of U  17.2      74  0.0019   14.5   1.5   21    4-24     53-73  (76)
  7 PRK00888 ftsB cell division pr  12.7      85  0.0022   14.2   0.8   23   50-72      9-31  (105)
  8 pfam08636 Pkr1 ER protein Pkr1  12.2   1E+02  0.0027   13.7   1.2   11   53-63     51-61  (75)
  9 KOG2574 consensus               10.5      87  0.0022   14.1   0.3   13   58-70    474-486 (492)
 10 TIGR02884 spore_pdaA delta-lac  10.2 1.5E+02  0.0039   12.9   1.5   20   13-32     25-46  (225)

No 1  
>pfam04663 Phenol_monoox Phenol hydroxylase conserved region. Under aerobic conditions, phenol is usually hydroxylated to catechol and degraded via the meta or ortho pathways. Two types of phenol hydroxylase are known: one is a multi-component enzyme the other is a single-component monooxygenase. This region is found in both types of enzymes.
Probab=38.14  E-value=15  Score=18.16  Aligned_cols=14  Identities=36%  Similarity=1.016  Sum_probs=11.5

Q ss_pred             EEEEEECCCCEEEE
Q ss_conf             04755238717776
Q gi|254780235|r   24 DMYLGWDNNSMFIL   37 (74)
Q Consensus        24 dmylgwdnnsmfil   37 (74)
                      =.|+|||+.-||--
T Consensus        13 LlYigWd~HllFca   26 (67)
T pfam04663        13 LLYVGWDDHLLFCA   26 (67)
T ss_pred             EEEEEECCCEEECC
T ss_conf             89950032211015


No 2  
>pfam10828 DUF2570 Protein of unknown function (DUF2570). This is a family of proteins with unknown function.
Probab=34.28  E-value=23  Score=17.16  Aligned_cols=23  Identities=30%  Similarity=0.619  Sum_probs=18.6

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             99999999999964787247880
Q gi|254780235|r   45 MMEKLVCLLLCVCGMLWFSSSGI   67 (74)
Q Consensus        45 mmeklvclllcvcgmlwfsssgi   67 (74)
                      ..--|.++.|-.||-+|.-|+-|
T Consensus         5 i~~~l~~lilgL~gwlw~QS~~I   27 (110)
T pfam10828         5 IKATLAALILGLGGWSWYQSQKI   27 (110)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999998888


No 3  
>pfam04272 Phospholamban Phospholamban. The regulation of calcium levels across the membrane of the sarcoplasmic reticulum involves the interplay of many membrane proteins. Phospholamban is a 52 residue integral membrane protein that is involved in reversibly inhibiting the Ca(2+) pump and regulating the flow of Ca ions across the sarcoplasmic reticulum membrane during muscle contraction and relaxation. Phospholamban is thought to form a pentamer in the membrane.
Probab=24.37  E-value=64  Score=14.86  Aligned_cols=23  Identities=48%  Similarity=0.816  Sum_probs=15.9

Q ss_pred             EHHHHHHHHHHHHHHHH-HHHHHH
Q ss_conf             06799999999999999-996478
Q gi|254780235|r   38 KQEFFIFMMEKLVCLLL-CVCGML   60 (74)
Q Consensus        38 kqeffifmmeklvclll-cvcgml   60 (74)
                      -||.|+-.---|.|||| |.--||
T Consensus        28 lq~lfvnfclilicllliciivml   51 (52)
T pfam04272        28 LQNLFINFCLILICLLLICIIVML   51 (52)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999999996


No 4  
>KOG4703 consensus
Probab=24.33  E-value=1.2  Score=23.93  Aligned_cols=62  Identities=27%  Similarity=0.543  Sum_probs=34.3

Q ss_pred             HHHHHCCCEEEEEEECE------EEEEECCCCEEEEEHHHHHHHHHHHHHHH---HHHHHHHHHCCCCCEE
Q ss_conf             64442125378986110------47552387177760679999999999999---9996478724788077
Q gi|254780235|r    8 LFSFCKAGTVFLSLKKD------MYLGWDNNSMFILKQEFFIFMMEKLVCLL---LCVCGMLWFSSSGIFA   69 (74)
Q Consensus         8 lfsfckagtvflslkkd------mylgwdnnsmfilkqeffifmmeklvcll---lcvcgmlwfsssgifa   69 (74)
                      +-|||-+|..-..+...      -.+-....+--.++.|+..---|.+.-.+   +-+||.-|+|...||.
T Consensus        14 igsfc~~gD~h~A~askcpvh~salee~AtEkS~mledeWm~d~aErl~RmlpggiHi~giaw~SdKK~F~   84 (431)
T KOG4703          14 IGSFCLAGDFHNALASKCPVHRSALEEFATEKSIMLEDEWMFDEAERLERMLPGGIHICGIAWASDKKIFC   84 (431)
T ss_pred             EEEHHHCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCEEEEEEECCCCCCEEE
T ss_conf             64121065188997623862067898766566676787652538899975066844898653024552221


No 5  
>pfam10856 DUF2678 Protein of unknown function (DUF2678). This family of proteins has no known function.
Probab=22.45  E-value=50  Score=15.42  Aligned_cols=28  Identities=32%  Similarity=0.686  Sum_probs=18.2

Q ss_pred             EHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             06799999999999999996478724788
Q gi|254780235|r   38 KQEFFIFMMEKLVCLLLCVCGMLWFSSSG   66 (74)
Q Consensus        38 kqeffifmmeklvclllcvcgmlwfsssg   66 (74)
                      |-.-.|+-|- ..-.+||+|.-|+|..-|
T Consensus        86 KfR~Liyy~~-~~iVlLciCAnLYFh~vg  113 (114)
T pfam10856        86 KFRNLIYYNL-FSIVLLCLCANLYFHDVG  113 (114)
T ss_pred             HHHHHHHHHH-HHHHHHHHHHHHHHHHCC
T ss_conf             9999999999-999999998898875347


No 6  
>pfam10790 DUF2604 Protein of Unknown function (DUF2604). Family of bacterial proteins with undetermined function.
Probab=17.24  E-value=74  Score=14.52  Aligned_cols=21  Identities=38%  Similarity=0.532  Sum_probs=14.8

Q ss_pred             HHHHHHHHHCCCEEEEEEECE
Q ss_conf             565564442125378986110
Q gi|254780235|r    4 KEIFLFSFCKAGTVFLSLKKD   24 (74)
Q Consensus         4 keiflfsfckagtvflslkkd   24 (74)
                      |.|--|.|...++.|||||..
T Consensus        53 kkied~gftng~klflslkag   73 (76)
T pfam10790        53 KKVEDFGFTNGVKLFLSLKAG   73 (76)
T ss_pred             CHHHHCCCCCCCEEEEEEECC
T ss_conf             202330503563699996224


No 7  
>PRK00888 ftsB cell division protein FtsB; Reviewed
Probab=12.68  E-value=85  Score=14.19  Aligned_cols=23  Identities=30%  Similarity=0.629  Sum_probs=15.4

Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             99999996478724788077864
Q gi|254780235|r   50 VCLLLCVCGMLWFSSSGIFAYLN   72 (74)
Q Consensus        50 vclllcvcgmlwfsssgifayln   72 (74)
                      +.+++-.---+||+..|++.|..
T Consensus         9 ~~ll~~LQY~lwfg~~g~~~~~~   31 (105)
T PRK00888          9 LALLVWLQYPLWFGKNGWLDYHR   31 (105)
T ss_pred             HHHHHHHHHHHHCCCCCHHHHHH
T ss_conf             99999999999404896999999


No 8  
>pfam08636 Pkr1 ER protein Pkr1. Pkr1 has been identified as an ER protein of unknown function.
Probab=12.20  E-value=1e+02  Score=13.71  Aligned_cols=11  Identities=45%  Similarity=0.948  Sum_probs=8.7

Q ss_pred             HHHHHHHHHHC
Q ss_conf             99996478724
Q gi|254780235|r   53 LLCVCGMLWFS   63 (74)
Q Consensus        53 llcvcgmlwfs   63 (74)
                      |++.||.||.|
T Consensus        51 L~~i~~~LW~s   61 (75)
T pfam08636        51 LSVLAGGLWWS   61 (75)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999


No 9  
>KOG2574 consensus
Probab=10.49  E-value=87  Score=14.15  Aligned_cols=13  Identities=46%  Similarity=0.652  Sum_probs=7.6

Q ss_pred             HHHHHCCCCCEEE
Q ss_conf             4787247880778
Q gi|254780235|r   58 GMLWFSSSGIFAY   70 (74)
Q Consensus        58 gmlwfsssgifay   70 (74)
                      .--|||++|-|.-
T Consensus       474 ~~~yFS~~g~F~~  486 (492)
T KOG2574         474 NSKYFSSSGSFSK  486 (492)
T ss_pred             HCCEECCCCCEEE
T ss_conf             2141236774352


No 10 
>TIGR02884 spore_pdaA delta-lactam-biosynthetic de-N-acetylase; InterPro: IPR014235    Muramic delta-lactam is an unusual constituent of peptidoglycan, found only in bacterial spores, in the peptidoglycan wall or spore cortex. This entry represents a subset of the larger polysaccharide deacetylase family that is specifically involved in delta-lactam biosynthesis. PdaA from Bacillus subtilis acts immediately after CwlD, an N-acetylmuramoyl-L-alanine amidase and performs a de-N-acetylation. PdaA may also perform the subsequent transpeptidation that leads to lactam ring formation, as heterologous expression in Escherichia coli of CwlD and PdaA together is sufficient for delta-lactam production..
Probab=10.19  E-value=1.5e+02  Score=12.87  Aligned_cols=20  Identities=40%  Similarity=0.644  Sum_probs=14.3

Q ss_pred             CCCEEEE--EEECEEEEEECCC
Q ss_conf             1253789--8611047552387
Q gi|254780235|r   13 KAGTVFL--SLKKDMYLGWDNN   32 (74)
Q Consensus        13 kagtvfl--slkkdmylgwdnn   32 (74)
                      |..+.|+  +-+|..||-.||.
T Consensus        25 Ky~~~y~GDt~~K~iYLTFDnG   46 (225)
T TIGR02884        25 KYNAYYLGDTSKKVIYLTFDNG   46 (225)
T ss_pred             HCCEEEEECCCCEEEEEECCCC
T ss_conf             2674886338720488514355


Done!