HHsearch alignment for GI: 254780236 and conserved domain: COG0203

>COG0203 RplQ Ribosomal protein L17 [Translation, ribosomal structure and biogenesis].
Probab=100.00  E-value=0  Score=329.24  Aligned_cols=116  Identities=65%  Similarity=0.961  Sum_probs=115.6

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEECHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCHHHHHHHH
Q ss_conf             99888899999788999999999999998689378759999998864216762311387677889998725668899999
Q gi|254780236|r    1 MRHAISGRKLNRTSSHRKAMFSNMAASIIWHEQIVTTLPKAKELRPIVEKLVTLGKKGGLHSLRLAISKIGDVDVVNKLF   80 (136)
Q Consensus         1 MrH~~~~rklgr~~~hR~allrnl~~~Li~herI~TT~~KAKelr~~aEklIt~AK~~~~~~rr~~~~~l~~~~~v~kLf   80 (136)
T Consensus         1 Mrh~~~~rkl~rtsshR~amlrnla~sLi~he~I~TT~~KAKelr~~vEkLITlaK~~~l~~RR~a~~~l~d~~~v~kLF   80 (116)
T COG0203           1 MRHRKKGRKLGRTSSHRKAMLRNLATSLIEHERIETTLPKAKELRRVVEKLITLAKKGDLANRRLAFARLRDKDAVKKLF   80 (116)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEECHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCHHHHHHHH
T ss_conf             99765678789877999999999999998738656337889999999999988850344888999998712189999999


Q ss_pred             HHHHHHHCCCCCCEEEEEECCCCCCCCCCEEEEEEE
Q ss_conf             999988505877559987537899988757999952
Q gi|254780236|r   81 GIIAKRYSDRSGGYLRIMKRGFRYGDSAPMAVIEFV  116 (136)
Q Consensus        81 ~~l~prf~~R~GGYTRi~kl~~R~gD~A~ma~iElV  116 (136)
T Consensus        81 ~~iapry~~R~GGYtRIlK~g~R~GD~A~maiiElV  116 (116)
T COG0203          81 DEIAPRYAERNGGYTRILKLGFRRGDNAPMAIIELV  116 (116)
T ss_pred             HHHCHHHCCCCCCEEEEEECCCCCCCCCCEEEEEEC
T ss_conf             985723336899726777537888888753777729