HHsearch alignment for GI: 254780236 and conserved domain: KOG3280

>KOG3280 consensus.
Probab=100.00  E-value=1.2e-42  Score=271.66  Aligned_cols=128  Identities=42%  Similarity=0.664  Sum_probs=121.8

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEECHHHHHHHHHHHHHHHHHH-CCCCHHHH--HHHHHHHCCHHHHH
Q ss_conf             9988889999978899999999999999868937875999999886421676231-13876778--89998725668899
Q gi|254780236|r    1 MRHAISGRKLNRTSSHRKAMFSNMAASIIWHEQIVTTLPKAKELRPIVEKLVTLG-KKGGLHSL--RLAISKIGDVDVVN   77 (136)
Q Consensus         1 MrH~~~~rklgr~~~hR~allrnl~~~Li~herI~TT~~KAKelr~~aEklIt~A-K~~~~~~r--r~~~~~l~~~~~v~   77 (136)
T Consensus         8 mt~~~~~~Klgr~~~~R~~lLR~lvt~LvkHErIe~t~ara~Ear~~aEklIt~~~k~g~~~~~~~~~a~~~l~ekdli~   87 (171)
T KOG3280           8 MTHGRRKLKLGRPPAHRLALLRNLVTQLVKHERIETTWARAKEARRYAEKLITLGKKAGSLHERTARMADGWLREKDLLH   87 (171)
T ss_pred             ECCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCCCHHHH
T ss_conf             41440013137990889999999999997755666689889999999999999988508674899998734224005899


Q ss_pred             HHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCEEEEEEECCCCCCCCCCCH
Q ss_conf             999999988505877559987537899988757999952688662225402
Q gi|254780236|r   78 KLFGIIAKRYSDRSGGYLRIMKRGFRYGDSAPMAVIEFVDRDLSAKGTPVS  128 (136)
Q Consensus        78 kLf~~l~prf~~R~GGYTRi~kl~~R~gD~A~ma~iElVd~~~~~~~~~~~  128 (136)
T Consensus        88 KlF~vl~pRY~dr~ggYTRllrlppr~~d~apmavlE~~Gn~~p~~~a~~p  138 (171)
T KOG3280          88 KLFTVLAPRYKDRNGGYTRLLRLPPRRGDRAPMAVLELVGNPLPQQAADRP  138 (171)
T ss_pred             HHHHHHCHHHCCCCCCCEEHHCCCCCCCCCCCCEEEEECCCCCCCCCCCCC
T ss_conf             999986515326888700000267533455672344432776643357984