Query gi|254780236|ref|YP_003064649.1| 50S ribosomal protein L17 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 136 No_of_seqs 117 out of 1412 Neff 4.8 Searched_HMMs 39220 Date Tue May 24 00:06:32 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780236.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK05591 rplQ 50S ribosomal pr 100.0 0 0 331.0 15.7 117 1-117 1-117 (117) 2 COG0203 RplQ Ribosomal protein 100.0 0 0 329.2 13.8 116 1-116 1-116 (116) 3 TIGR00059 L17 ribosomal protei 100.0 0 0 326.3 8.8 111 7-117 2-125 (125) 4 PTZ00076 60S ribosomal protein 100.0 0 0 293.4 9.5 125 4-128 16-142 (257) 5 pfam01196 Ribosomal_L17 Riboso 100.0 1.1E-42 0 271.9 12.0 97 20-116 1-97 (97) 6 KOG3280 consensus 100.0 1.2E-42 0 271.7 9.3 128 1-128 8-138 (171) 7 PRK11823 DNA repair protein Ra 55.3 14 0.00035 18.1 3.1 83 42-127 190-279 (454) 8 TIGR02885 spore_sigF RNA polym 35.7 30 0.00077 16.1 2.4 45 51-101 1-45 (231) 9 PRK11536 hypothetical protein; 34.2 39 0.00098 15.4 2.8 41 68-119 125-166 (223) 10 TIGR01173 glmU UDP-N-acetylglu 28.1 46 0.0012 15.0 2.3 73 47-123 64-169 (461) 11 cd01452 VWA_26S_proteasome_sub 25.9 54 0.0014 14.6 2.6 47 88-134 78-132 (187) 12 TIGR03060 PS_II_psb29 photosys 25.8 47 0.0012 14.9 2.0 80 12-103 68-148 (214) 13 cd05399 NT_Rel-Spo_like Nucleo 25.0 5.8 0.00015 20.3 -2.8 79 19-97 5-99 (129) 14 PRK13266 Thf1-like protein; Re 24.4 58 0.0015 14.4 2.4 80 12-103 68-149 (224) 15 COG4463 CtsR Transcriptional r 24.3 44 0.0011 15.1 1.6 13 91-103 64-76 (153) 16 KOG2188 consensus 23.1 61 0.0016 14.3 3.7 40 50-89 373-413 (650) 17 COG5095 TAF6 Transcription ini 23.1 61 0.0016 14.3 3.8 31 42-72 193-224 (450) 18 cd06541 ASCH ASC-1 homology or 22.6 63 0.0016 14.2 3.5 36 89-130 31-66 (105) 19 cd01121 Sms Sms (bacterial rad 20.9 68 0.0017 14.0 3.4 82 43-127 184-272 (372) 20 TIGR02817 adh_fam_1 zinc-bindi 20.0 71 0.0018 13.9 2.5 23 18-40 285-307 (338) No 1 >PRK05591 rplQ 50S ribosomal protein L17; Validated Probab=100.00 E-value=0 Score=331.05 Aligned_cols=117 Identities=64% Similarity=0.955 Sum_probs=116.6 Q ss_pred CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEECHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCHHHHHHHH Q ss_conf 99888899999788999999999999998689378759999998864216762311387677889998725668899999 Q gi|254780236|r 1 MRHAISGRKLNRTSSHRKAMFSNMAASIIWHEQIVTTLPKAKELRPIVEKLVTLGKKGGLHSLRLAISKIGDVDVVNKLF 80 (136) Q Consensus 1 MrH~~~~rklgr~~~hR~allrnl~~~Li~herI~TT~~KAKelr~~aEklIt~AK~~~~~~rr~~~~~l~~~~~v~kLf 80 (136) |||++++++|||+++||++|||||+++||+||+|+||++||||+|+|+|+|||+||+|++|++|++.+||.|+++++||| T Consensus 1 MrH~~~~~klgr~~~hR~allrnl~~~Li~h~rI~TT~~KAKelr~~~EklIT~AK~~~~~~rR~~~~~l~~~~~v~kLf 80 (117) T PRK05591 1 MRHRKSGRKLGRTSSHRKAMLRNLATSLIEHERIKTTLPKAKELRRVVEKLITLAKKGDLAARRQAFARLRDKEAVHKLF 80 (117) T ss_pred CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEECHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCHHHHHHHH T ss_conf 99888889899886999999999999999669687239999999999999998871785888999998548889999999 Q ss_pred HHHHHHHCCCCCCEEEEEECCCCCCCCCCEEEEEEEC Q ss_conf 9999885058775599875378999887579999526 Q gi|254780236|r 81 GIIAKRYSDRSGGYLRIMKRGFRYGDSAPMAVIEFVD 117 (136) Q Consensus 81 ~~l~prf~~R~GGYTRi~kl~~R~gD~A~ma~iElVd 117 (136) ++|+|||++||||||||+|+|+|.||+|+||+||||| T Consensus 81 ~~iapry~~R~GGYTRI~kl~~R~gD~A~ma~iElVd 117 (117) T PRK05591 81 DELAPRYADRNGGYTRILKLGFRRGDNAPMAIIELVD 117 (117) T ss_pred HHHHHHHCCCCCCEEEEEECCCCCCCCCCEEEEEEEC T ss_conf 9998996779987588986389999988777998309 No 2 >COG0203 RplQ Ribosomal protein L17 [Translation, ribosomal structure and biogenesis] Probab=100.00 E-value=0 Score=329.24 Aligned_cols=116 Identities=65% Similarity=0.961 Sum_probs=115.6 Q ss_pred CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEECHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCHHHHHHHH Q ss_conf 99888899999788999999999999998689378759999998864216762311387677889998725668899999 Q gi|254780236|r 1 MRHAISGRKLNRTSSHRKAMFSNMAASIIWHEQIVTTLPKAKELRPIVEKLVTLGKKGGLHSLRLAISKIGDVDVVNKLF 80 (136) Q Consensus 1 MrH~~~~rklgr~~~hR~allrnl~~~Li~herI~TT~~KAKelr~~aEklIt~AK~~~~~~rr~~~~~l~~~~~v~kLf 80 (136) |||++++++|||++|||+||++||++|||.||+|+||++||||+|+++|+|||+||+|++|++|+++++|.|++++.||| T Consensus 1 Mrh~~~~rkl~rtsshR~amlrnla~sLi~he~I~TT~~KAKelr~~vEkLITlaK~~~l~~RR~a~~~l~d~~~v~kLF 80 (116) T COG0203 1 MRHRKKGRKLGRTSSHRKAMLRNLATSLIEHERIETTLPKAKELRRVVEKLITLAKKGDLANRRLAFARLRDKDAVKKLF 80 (116) T ss_pred CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEECHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCHHHHHHHH T ss_conf 99765678789877999999999999998738656337889999999999988850344888999998712189999999 Q ss_pred HHHHHHHCCCCCCEEEEEECCCCCCCCCCEEEEEEE Q ss_conf 999988505877559987537899988757999952 Q gi|254780236|r 81 GIIAKRYSDRSGGYLRIMKRGFRYGDSAPMAVIEFV 116 (136) Q Consensus 81 ~~l~prf~~R~GGYTRi~kl~~R~gD~A~ma~iElV 116 (136) ++|+|||.+||||||||+|+|+|.|||||||+|||| T Consensus 81 ~~iapry~~R~GGYtRIlK~g~R~GD~A~maiiElV 116 (116) T COG0203 81 DEIAPRYAERNGGYTRILKLGFRRGDNAPMAIIELV 116 (116) T ss_pred HHHCHHHCCCCCCEEEEEECCCCCCCCCCEEEEEEC T ss_conf 985723336899726777537888888753777729 No 3 >TIGR00059 L17 ribosomal protein L17; InterPro: IPR000456 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites , . About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits. Many of ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome , . Ribosomal protein L17 is one of the proteins from the large ribosomal subunit. Bacterial L17 is a protein of 120 to 130 amino-acid residues while yeast YmL8 is twice as large (238 residues). The N-terminal half of YmL8 is colinear with the sequence of L17 from Escherichia coli.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome. Probab=100.00 E-value=0 Score=326.30 Aligned_cols=111 Identities=55% Similarity=0.783 Sum_probs=109.0 Q ss_pred C-CCCCCCHHHHHHHHHHHHHHHHHCCEEEECHHHHHHHHHHHHHHHHHHC----CCCHHHHHHHHHHHCCHHH------ Q ss_conf 9-9999788999999999999998689378759999998864216762311----3876778899987256688------ Q gi|254780236|r 7 G-RKLNRTSSHRKAMFSNMAASIIWHEQIVTTLPKAKELRPIVEKLVTLGK----KGGLHSLRLAISKIGDVDV------ 75 (136) Q Consensus 7 ~-rklgr~~~hR~allrnl~~~Li~herI~TT~~KAKelr~~aEklIt~AK----~~~~~~rr~~~~~l~~~~~------ 75 (136) + |||||+++||+||||||+++||.||+|+||.+||||+|+++|||||+|| .|++|++|.+.+||.|+++ T Consensus 2 ~~rkLgr~s~hR~Allrnl~~~L~~he~I~TT~~KAKe~r~~~EklIT~AKrait~d~~~aRR~~~~~~~n~~~~~~dN~ 81 (125) T TIGR00059 2 YIRKLGRTSAHRKALLRNLASALIRHEKIETTLAKAKELRRVVEKLITLAKRAITVDNVNARREAKAYIRNKEALDVDNR 81 (125) T ss_pred CCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCHHHHHHHH T ss_conf 88888887588999999999999862886203578888888885776676453046888999999998731024456579 Q ss_pred --HHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCEEEEEEEC Q ss_conf --999999999885058775599875378999887579999526 Q gi|254780236|r 76 --VNKLFGIIAKRYSDRSGGYLRIMKRGFRYGDSAPMAVIEFVD 117 (136) Q Consensus 76 --v~kLf~~l~prf~~R~GGYTRi~kl~~R~gD~A~ma~iElVd 117 (136) ++|||.+|||||++|+||||||+|+|+|.||+||||+||||| T Consensus 82 ~l~~kLF~~iaPry~~R~GGYTRilklg~RrGD~A~mA~iELVD 125 (125) T TIGR00059 82 QLLNKLFSEIAPRYAQRNGGYTRILKLGPRRGDAAEMAIIELVD 125 (125) T ss_pred HHHHHHHHHHCCCCCCCCCCCEEEECCCCCCCCCCCHHHHHHCC T ss_conf 99998765305532348778313000567788863014553069 No 4 >PTZ00076 60S ribosomal protein L17; Provisional Probab=100.00 E-value=0 Score=293.41 Aligned_cols=125 Identities=29% Similarity=0.346 Sum_probs=117.9 Q ss_pred CCCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEECHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCHHHHHHHHHHH Q ss_conf 88899999788999999999999998689378759999998864216762311387677889998725668899999999 Q gi|254780236|r 4 AISGRKLNRTSSHRKAMFSNMAASIIWHEQIVTTLPKAKELRPIVEKLVTLGKKGGLHSLRLAISKIGDVDVVNKLFGII 83 (136) Q Consensus 4 ~~~~rklgr~~~hR~allrnl~~~Li~herI~TT~~KAKelr~~aEklIt~AK~~~~~~rr~~~~~l~~~~~v~kLf~~l 83 (136) +..+|||||+++|||+|||||+++||+||||+||++||||+|+|||+|||+||+|+++|+|+|.+++.+.+++.|||+++ T Consensus 16 ~R~FRKl~r~s~HR~amlRnmv~~LI~heRIeTTl~KAKElrr~AE~lItlAK~~t~~arr~a~s~lRt~e~~~KLF~el 95 (257) T PTZ00076 16 RRLFRRAHKQPHHKWDSIKNQLNELLKYGRIETTLTKAKELQGYAEELIYLAKKDNAENNLKVESMLRTAQGRRKLYEFY 95 (257) T ss_pred HHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCHHHHHHHHHHH T ss_conf 77888707994155999999999998751121120768999999999999860488888999998854699999999986 Q ss_pred HHHHCCCCCCEEEEEE-CCCCCCCCCCEEEEEEECCCCCCCC-CCCH Q ss_conf 9885058775599875-3789998875799995268866222-5402 Q gi|254780236|r 84 AKRYSDRSGGYLRIMK-RGFRYGDSAPMAVIEFVDRDLSAKG-TPVS 128 (136) Q Consensus 84 ~prf~~R~GGYTRi~k-l~~R~gD~A~ma~iElVd~~~~~~~-~~~~ 128 (136) +|||++||||||||++ .++|.||+||||+|||||+|.+... .|+. T Consensus 96 ~PRYkdRpggyTRILn~~~~R~gDaAPMAyIEfVDRpGElRpAKPvg 142 (257) T PTZ00076 96 VPLYRHRPFFFTRIINQWKLRLRDAAPLAFIEFIDRPGELRPAKPVG 142 (257) T ss_pred HHHHCCCCCCEEHHHHHHCCCCCCCCCEEEEEECCCCCCCCCCCCCC T ss_conf 43540588761102443055555667604556506877636688744 No 5 >pfam01196 Ribosomal_L17 Ribosomal protein L17. Probab=100.00 E-value=1.1e-42 Score=271.86 Aligned_cols=97 Identities=59% Similarity=0.882 Sum_probs=96.1 Q ss_pred HHHHHHHHHHHCCEEEECHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCEEEEEE Q ss_conf 99999999986893787599999988642167623113876778899987256688999999999885058775599875 Q gi|254780236|r 20 MFSNMAASIIWHEQIVTTLPKAKELRPIVEKLVTLGKKGGLHSLRLAISKIGDVDVVNKLFGIIAKRYSDRSGGYLRIMK 99 (136) Q Consensus 20 llrnl~~~Li~herI~TT~~KAKelr~~aEklIt~AK~~~~~~rr~~~~~l~~~~~v~kLf~~l~prf~~R~GGYTRi~k 99 (136) |||||+++||+||+|+||++||||+|+|+|+|||+||+|++|++|++.++|.|+++++|||++++|||++||||||||+| T Consensus 1 llrnl~~~Li~herI~TT~~KAKelr~~~ErlIt~AK~~~~~~rr~~~~~l~~~~~v~kLf~~iapry~~R~GGYTRi~k 80 (97) T pfam01196 1 LLRNLATSLIRHERIETTLAKAKELRPYAEKLITLAKKGDLHARRQALSFLRDKEAVKKLFDELAPRYADRNGGYTRIIK 80 (97) T ss_pred CHHHHHHHHHHCCEEEECHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCCEEEEEE T ss_conf 96899999984796885789899999999999999972878889999962187468999999998986679988488886 Q ss_pred CCCCCCCCCCEEEEEEE Q ss_conf 37899988757999952 Q gi|254780236|r 100 RGFRYGDSAPMAVIEFV 116 (136) Q Consensus 100 l~~R~gD~A~ma~iElV 116 (136) +|+|.||+|+||+|||| T Consensus 81 l~~R~gD~A~ma~iElV 97 (97) T pfam01196 81 LGPRRGDNAPMAIIELV 97 (97) T ss_pred CCCCCCCCCCEEEEEEC T ss_conf 48999999885899749 No 6 >KOG3280 consensus Probab=100.00 E-value=1.2e-42 Score=271.66 Aligned_cols=128 Identities=42% Similarity=0.664 Sum_probs=121.8 Q ss_pred CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEECHHHHHHHHHHHHHHHHHH-CCCCHHHH--HHHHHHHCCHHHHH Q ss_conf 9988889999978899999999999999868937875999999886421676231-13876778--89998725668899 Q gi|254780236|r 1 MRHAISGRKLNRTSSHRKAMFSNMAASIIWHEQIVTTLPKAKELRPIVEKLVTLG-KKGGLHSL--RLAISKIGDVDVVN 77 (136) Q Consensus 1 MrH~~~~rklgr~~~hR~allrnl~~~Li~herI~TT~~KAKelr~~aEklIt~A-K~~~~~~r--r~~~~~l~~~~~v~ 77 (136) |+|+....|+|+++.||.+|||||+|+||+||||+||++||||+|+|||+|||+| |.|+++++ +++..||..+++++ T Consensus 8 mt~~~~~~Klgr~~~~R~~lLR~lvt~LvkHErIe~t~ara~Ear~~aEklIt~~~k~g~~~~~~~~~a~~~l~ekdli~ 87 (171) T KOG3280 8 MTHGRRKLKLGRPPAHRLALLRNLVTQLVKHERIETTWARAKEARRYAEKLITLGKKAGSLHERTARMADGWLREKDLLH 87 (171) T ss_pred ECCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCCCHHHH T ss_conf 41440013137990889999999999997755666689889999999999999988508674899998734224005899 Q ss_pred HHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCEEEEEEECCCCCCCCCCCH Q ss_conf 999999988505877559987537899988757999952688662225402 Q gi|254780236|r 78 KLFGIIAKRYSDRSGGYLRIMKRGFRYGDSAPMAVIEFVDRDLSAKGTPVS 128 (136) Q Consensus 78 kLf~~l~prf~~R~GGYTRi~kl~~R~gD~A~ma~iElVd~~~~~~~~~~~ 128 (136) |||++|+|||.||+|||||++++.+|.||+|+||+|||++++.+.-..+.. T Consensus 88 KlF~vl~pRY~dr~ggYTRllrlppr~~d~apmavlE~~Gn~~p~~~a~~p 138 (171) T KOG3280 88 KLFTVLAPRYKDRNGGYTRLLRLPPRRGDRAPMAVLELVGNPLPQQAADRP 138 (171) T ss_pred HHHHHHCHHHCCCCCCCEEHHCCCCCCCCCCCCEEEEECCCCCCCCCCCCC T ss_conf 999986515326888700000267533455672344432776643357984 No 7 >PRK11823 DNA repair protein RadA; Provisional Probab=55.32 E-value=14 Score=18.09 Aligned_cols=83 Identities=18% Similarity=0.390 Sum_probs=54.7 Q ss_pred HHHHHHHHHHHHHHCCCCHHHHHHH------HHHHCCHHHHHHHHHHHHHHHCCCCCCEEEEEEC-CCCCCCCCCEEEEE Q ss_conf 9988642167623113876778899------9872566889999999998850587755998753-78999887579999 Q gi|254780236|r 42 KELRPIVEKLVTLGKKGGLHSLRLA------ISKIGDVDVVNKLFGIIAKRYSDRSGGYLRIMKR-GFRYGDSAPMAVIE 114 (136) Q Consensus 42 Kelr~~aEklIt~AK~~~~~~rr~~------~~~l~~~~~v~kLf~~l~prf~~R~GGYTRi~kl-~~R~gD~A~ma~iE 114 (136) -++|--+..|+.+||..+... .+ ...|--+.++.++.|.+. -|+.-.+..-||++. .+|.|..-++++.| T Consensus 190 sQVre~a~~L~~~AK~~~i~~--~lVGHVTKdG~iAGPkvLEHmVDtVl-~fEGd~~~~~RiLR~~KNRFG~t~EiGvFe 266 (454) T PRK11823 190 SQVRECAAELTRLAKQSGIAV--FLVGHVTKEGAIAGPRVLEHMVDTVL-YFEGDRHSRFRILRAVKNRFGATNEIGVFE 266 (454) T ss_pred HHHHHHHHHHHHHHHHCCCCE--EEEEEECCCCCCCCCHHHHHHHCEEE-EECCCCCCCCEEEEEECCCCCCCCEEEEEE T ss_conf 999999999999997449828--99997726776466145222010468-751576655024563124677666058998 Q ss_pred EECCCCCCCCCCC Q ss_conf 5268866222540 Q gi|254780236|r 115 FVDRDLSAKGTPV 127 (136) Q Consensus 115 lVd~~~~~~~~~~ 127 (136) ..+.-+..-.+|- T Consensus 267 M~~~GL~~v~nPS 279 (454) T PRK11823 267 MTEKGLREVSNPS 279 (454) T ss_pred ECCCCCEECCCHH T ss_conf 6168845668877 No 8 >TIGR02885 spore_sigF RNA polymerase sigma-F factor; InterPro: IPR014236 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme . RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes. With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognized by the major sigma factors , . Members of this entry represent RNA polymerase sigma factor F. Within the Firmicutes, Sigma-F is specifically, and universally, a component of the endospore formation program, and is expressed in the forespore to turn on the expression of dozens of genes. It is closely related to sigma-G, which is also expressed in the forespore.; GO: 0003677 DNA binding, 0003700 transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, 0006355 regulation of transcription DNA-dependent. Probab=35.68 E-value=30 Score=16.08 Aligned_cols=45 Identities=27% Similarity=0.381 Sum_probs=28.5 Q ss_pred HHHHHCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCEEEEEECC Q ss_conf 762311387677889998725668899999999988505877559987537 Q gi|254780236|r 51 LVTLGKKGGLHSLRLAISKIGDVDVVNKLFGIIAKRYSDRSGGYLRIMKRG 101 (136) Q Consensus 51 lIt~AK~~~~~~rr~~~~~l~~~~~v~kLf~~l~prf~~R~GGYTRi~kl~ 101 (136) ||.+||.||..|+-.+.. .--+|..-++.||.+|=.-|==+...| T Consensus 1 Li~~a~~GDk~A~dkLi~------~N~~LV~siv~rF~nRGYe~eDlFQIG 45 (231) T TIGR02885 1 LIKLAKEGDKEARDKLIE------ENLRLVSSIVKRFLNRGYEYEDLFQIG 45 (231) T ss_pred CCHHHHHHHHHHHHHHHH------HCCHHHHHHHHHHHCCCCCCCHHHHHH T ss_conf 904567404899999987------233468999998520688700002221 No 9 >PRK11536 hypothetical protein; Provisional Probab=34.24 E-value=39 Score=15.44 Aligned_cols=41 Identities=17% Similarity=0.273 Sum_probs=26.9 Q ss_pred HHHCCHHHHHHHHHHHHHHHCCCCCCEEEEEECC-CCCCCCCCEEEEEEECCC Q ss_conf 8725668899999999988505877559987537-899988757999952688 Q gi|254780236|r 68 SKIGDVDVVNKLFGIIAKRYSDRSGGYLRIMKRG-FRYGDSAPMAVIEFVDRD 119 (136) Q Consensus 68 ~~l~~~~~v~kLf~~l~prf~~R~GGYTRi~kl~-~R~gD~A~ma~iElVd~~ 119 (136) .....++++..+.+ ..|.|-|.||++-| ...|| -||||+++ T Consensus 125 ~r~~~~~~~~~~~~------tgrtGwY~RVL~~G~v~agD-----~i~l~~R~ 166 (223) T PRK11536 125 YHFDISDIAQLMQN------TGKVGWLYRVIAPGKVSADA-----PLELVSRV 166 (223) T ss_pred HHHCCCCHHHHHHH------HCCCEEEEEEECCCEECCCC-----EEEEEECC T ss_conf 88488129999998------48856999980263766999-----78997349 No 10 >TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882 N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2.7.7.23 from EC) is a trimeric bifunctional enzyme that catalyzes the last two sequential reactions in the de novo biosynthetic pathway for UDP-GlcNAc. The X-ray crystal structure of Escherichia coli GlmU in complex with UDP-GlcNAc and CoA has been determined to 2.1 A resolution and reveals a two-domain architecture that is responsible for these two reactions . The C-terminal domain is responsible for the CoA-dependent acetylation of Glc-1-PO(4) to GlcNAc-1-PO(4) and displays the longest left-handed parallel beta-helix observed to date. The acetyltransferase active site defined by the binding site for CoA makes use of residues from all three subunits and is positioned beneath an open cavity large enough to accommodate the Glc-1-PO(4) acetyl acceptor. The N-terminal domain catalyzes uridyl transfer from UTP to GlcNAc-1-PO(4) to form the final products UDP-GlcNAc and pyrophosphate. This domain is composed of a central seven-stranded beta-sheet surrounded by six alpha-helices in a Rossmann fold-like topology. ; GO: 0003977 UDP-N-acetylglucosamine diphosphorylase activity, 0009103 lipopolysaccharide biosynthetic process. Probab=28.05 E-value=46 Score=14.97 Aligned_cols=73 Identities=22% Similarity=0.246 Sum_probs=53.0 Q ss_pred HHHHHHHHHC----CC-CHHHHHHHHHHHC-----------------CHHHHH-HHHHHHHH-HH---------CCCCCC Q ss_conf 4216762311----38-7677889998725-----------------668899-99999998-85---------058775 Q gi|254780236|r 47 IVEKLVTLGK----KG-GLHSLRLAISKIG-----------------DVDVVN-KLFGIIAK-RY---------SDRSGG 93 (136) Q Consensus 47 ~aEklIt~AK----~~-~~~~rr~~~~~l~-----------------~~~~v~-kLf~~l~p-rf---------~~R~GG 93 (136) ..|+.|.|+- .| |=||..++.++|. +.+... .|.+.-.+ .= .+=|-| T Consensus 64 ~~d~t~~~v~Q~~qlGGTGHAv~~a~~~l~~~~~~~vLvLyGDvPLi~~eTL~m~Ll~~~~~~~~~~~tlLt~~l~DP~G 143 (461) T TIGR01173 64 ENDKTVNWVLQAEQLGGTGHAVLQALPFLSEDDDGRVLVLYGDVPLISAETLEMRLLESHRQLNGAKVTLLTAKLEDPTG 143 (461) T ss_pred CCCCEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCC T ss_conf 79967999996889787289998711678886686089995887877567787798886300010451799987188895 Q ss_pred EEEEEECCCCCCCCCCEEEEEEECCCCCCC Q ss_conf 599875378999887579999526886622 Q gi|254780236|r 94 YLRIMKRGFRYGDSAPMAVIEFVDRDLSAK 123 (136) Q Consensus 94 YTRi~kl~~R~gD~A~ma~iElVd~~~~~~ 123 (136) |=||++ ..|++=++|||.-|-+.+-+ T Consensus 144 YGRI~r----~~~g~V~~IVE~KDA~~eqk 169 (461) T TIGR01173 144 YGRIIR----ENDGAVQAIVEEKDANEEQK 169 (461) T ss_pred CCEEEE----CCCCCEEEEECCCCCCHHHH T ss_conf 435898----48995899973359886980 No 11 >cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins. It is an ATP-dependent protease responsible for the bulk of non-lysosomal proteolysis in eukaryotes, often using covalent modification of proteins by ubiquitylation. It consists of a 20S proteolytic core particle (CP) and a 19S regulatory particle (RP). The CP is an ATP independent peptidase consisting of hydrolyzing activities. One or both ends of CP carry the RP that confers both ubiquitin and ATP dependence to the 26S proteosome. The RP's proposed functions include recognition of substrates and translocation of these to CP for proteolysis. The RP can dissociate into a stable lid and base subcomplexes. The base is composed of three non-ATPase subunits (Rpn 1, 2 and 10). A single residue in the vWA domain of Rpn10 has been implicated to be responsible for stabilizing the lid-base association. Probab=25.85 E-value=54 Score=14.58 Aligned_cols=47 Identities=9% Similarity=0.212 Sum_probs=31.2 Q ss_pred CCCCCCEEEEE--------ECCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHH Q ss_conf 05877559987--------537899988757999952688662225402567764 Q gi|254780236|r 88 SDRSGGYLRIM--------KRGFRYGDSAPMAVIEFVDRDLSAKGTPVSRKSHKV 134 (136) Q Consensus 88 ~~R~GGYTRi~--------kl~~R~gD~A~ma~iElVd~~~~~~~~~~~~~~~~~ 134 (136) .-.+||=..+. -|..|.+.+..|-+|=||++|.+.......+-.++. T Consensus 78 ~i~~~G~~~~~~~IqiA~LALKHRqnk~~~qRIv~FVgSPi~~~ek~l~~laKkl 132 (187) T cd01452 78 DVQPKGKANFITGIQIAQLALKHRQNKNQKQRIVAFVGSPIEEDEKDLVKLAKRL 132 (187) T ss_pred CCCCCCEECHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCCHHHHHHHHHHH T ss_conf 6771876518879999999972346777544799997898755789999999987 No 12 >TIGR03060 PS_II_psb29 photosystem II biogenesis protein Psp29. Psp29, originally designated sll1414 in Synechocystis 6803, is found universally in Cyanobacteria and in Arabidopsis. It was isolated and partially sequenced from purified photosystem II (PS II) in Synechocystis. While its function is unknown, mutant studies show an impairment in photosystem II biogenesis and/or stability, rather than in PS II core function. Probab=25.75 E-value=47 Score=14.94 Aligned_cols=80 Identities=20% Similarity=0.242 Sum_probs=52.9 Q ss_pred CCHHHHHHHHHHHHHHHHHCCEEEECHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCC Q ss_conf 78899999999999999868937875999999886421676231138767788999872566889999999998850587 Q gi|254780236|r 12 RTSSHRKAMFSNMAASIIWHEQIVTTLPKAKELRPIVEKLVTLGKKGGLHSLRLAISKIGDVDVVNKLFGIIAKRYSDRS 91 (136) Q Consensus 12 r~~~hR~allrnl~~~Li~herI~TT~~KAKelr~~aEklIt~AK~~~~~~rr~~~~~l~~~~~v~kLf~~l~prf~~R~ 91 (136) ++..|+-.++.-||.++= --+.+++..++++..+|+.-+... +.+|+............+...=.+.. T Consensus 68 ~Pee~~~~IF~Alc~s~~---------~dp~~~r~dA~~l~~~a~~~s~~~---i~~~l~~~~~~~~~~~~l~~~a~n~k 135 (214) T TIGR03060 68 RPEEHLDALFDALCNSNG---------FDPEQLREDAKQLLEQAKGKGLDE---ILSWLTQANLSNGGGDTLQGIAGRHK 135 (214) T ss_pred CCHHHHHHHHHHHHHHCC---------CCHHHHHHHHHHHHHHHHCCCHHH---HHHHHHCCCCCCCHHHHHHHHHCCCC T ss_conf 982569999999987348---------999999999999999997489999---99998504755411679998741787 Q ss_pred CCEEEEEECC-CC Q ss_conf 7559987537-89 Q gi|254780236|r 92 GGYLRIMKRG-FR 103 (136) Q Consensus 92 GGYTRi~kl~-~R 103 (136) .-|.|+.-+| ++ T Consensus 136 f~YSRl~AIGL~~ 148 (214) T TIGR03060 136 FKYSRLFAIGLYS 148 (214) T ss_pred CCHHHHHHHHHHH T ss_conf 4089999999999 No 13 >cd05399 NT_Rel-Spo_like Nucleotidyltransferase (NT) domain of RelA- and SpoT-like ppGpp synthetases and hydrolases. This family includes the catalytic domains of Escherichia coli ppGpp synthetase (RelA), ppGpp synthetase/hydrolase (SpoT), and related proteins. RelA synthesizes (p)ppGpp in response to amino-acid starvation and in association with ribosomes. (p)ppGpp triggers the bacterial stringent response. SpoT catalyzes (p)ppGpp synthesis under carbon limitation in a ribosome-independent manner. It also catalyzes (p)ppGpp degradation. Gram-negative bacteria have two enzymes involved in (p)ppGpp metabolism while most Gram-positive organisms have a single Rel-Spo enzyme (Rel), which both synthesizes and degrades (p)ppGpp. The Arabidopsis thaliana Rel-Spo proteins, At-RSH1,-2, and-3 appear to regulate a rapid (p)ppGpp-mediated response to pathogens and other stresses. This catalytic domain is found in association with an N-terminal HD domain and a C-terminal metal dependent phosphohydro Probab=25.03 E-value=5.8 Score=20.29 Aligned_cols=79 Identities=22% Similarity=0.320 Sum_probs=44.4 Q ss_pred HHHHHHHHHHHHCCEEEECHHHHHHHHHHHHHHHHHHCCC-------CHHHHHHHHHHHCCHH----HHHHHHHHHHHHH Q ss_conf 9999999999868937875999999886421676231138-------7677889998725668----8999999999885 Q gi|254780236|r 19 AMFSNMAASIIWHEQIVTTLPKAKELRPIVEKLVTLGKKG-------GLHSLRLAISKIGDVD----VVNKLFGIIAKRY 87 (136) Q Consensus 19 allrnl~~~Li~herI~TT~~KAKelr~~aEklIt~AK~~-------~~~~rr~~~~~l~~~~----~v~kLf~~l~prf 87 (136) ..+.+++.++..++.+.....+.|..-...+||....+.. |+...|.+..+..|-. ++...|+....++ T Consensus 5 ~~i~~~L~~~~~~~~~~~i~~RvK~~~S~~~Kl~rk~~~~~~~~~i~Dl~g~Rii~~~~~d~~~v~~~l~~~f~~~~~~~ 84 (129) T cd05399 5 EEIADLLRDAGIIGRVASVSGRVKSPYSIYEKLRRKGKDLPILDEITDLVGVRVVLLFVDDCYRVLDLLHSLFKVIPGRV 84 (129) T ss_pred HHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHCCCCCCHHHHCCHHEEEEEEECCHHHHHHHHHHHCCCCCCCCCC T ss_conf 99999999879988820896716997999999985488867687712014699999431679999999971798624411 Q ss_pred CC-----CCCCEEEE Q ss_conf 05-----87755998 Q gi|254780236|r 88 SD-----RSGGYLRI 97 (136) Q Consensus 88 ~~-----R~GGYTRi 97 (136) .| .++||--+ T Consensus 85 ~D~i~~pk~~GYrs~ 99 (129) T cd05399 85 KDYIAEPKENGYQSL 99 (129) T ss_pred CCCCCCCCCCCCCEE T ss_conf 466678888897878 No 14 >PRK13266 Thf1-like protein; Reviewed Probab=24.36 E-value=58 Score=14.41 Aligned_cols=80 Identities=21% Similarity=0.344 Sum_probs=56.7 Q ss_pred CCHHHHHHHHHHHHHHHHHCCEEEECHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCH-HHHHHHHHHHHHHHCCC Q ss_conf 78899999999999999868937875999999886421676231138767788999872566-88999999999885058 Q gi|254780236|r 12 RTSSHRKAMFSNMAASIIWHEQIVTTLPKAKELRPIVEKLVTLGKKGGLHSLRLAISKIGDV-DVVNKLFGIIAKRYSDR 90 (136) Q Consensus 12 r~~~hR~allrnl~~~Li~herI~TT~~KAKelr~~aEklIt~AK~~~~~~rr~~~~~l~~~-~~v~kLf~~l~prf~~R 90 (136) ++..|+-+++..||.++= --+.++|..++++..+|+..+... +.+||..+ +....|...+.-.-.+- T Consensus 68 ~Pee~~~~IF~Alc~s~~---------~dp~~~r~dA~~l~~~a~~~s~~~---i~~~l~~~~~~~~~l~~~~~~~~~~~ 135 (224) T PRK13266 68 RPEEHKDALFEALCQAVG---------FDPEQLREDAEQLLELAKGKSLDE---ILSWLTQKGGGANELLATLQAIANNS 135 (224) T ss_pred CCHHHHHHHHHHHHHHCC---------CCHHHHHHHHHHHHHHHHCCCHHH---HHHHHHHCCCCCCHHHHHHHHHHCCC T ss_conf 982569999999998448---------999999999999999987589999---99999735455506889999874278 Q ss_pred CCCEEEEEECC-CC Q ss_conf 77559987537-89 Q gi|254780236|r 91 SGGYLRIMKRG-FR 103 (136) Q Consensus 91 ~GGYTRi~kl~-~R 103 (136) +.-|.|+.-+| ++ T Consensus 136 ~f~YSRl~AIGL~~ 149 (224) T PRK13266 136 KFKYSRLFAIGLYT 149 (224) T ss_pred CCHHHHHHHHHHHH T ss_conf 73289999999999 No 15 >COG4463 CtsR Transcriptional repressor of class III stress genes [Transcription] Probab=24.34 E-value=44 Score=15.12 Aligned_cols=13 Identities=46% Similarity=1.043 Sum_probs=9.6 Q ss_pred CCCEEEEEECCCC Q ss_conf 7755998753789 Q gi|254780236|r 91 SGGYLRIMKRGFR 103 (136) Q Consensus 91 ~GGYTRi~kl~~R 103 (136) -|||-||+|..++ T Consensus 64 GGGYIRI~Kv~~~ 76 (153) T COG4463 64 GGGYIRIIKVEYS 76 (153) T ss_pred CCCEEEEEEECCC T ss_conf 8756999985125 No 16 >KOG2188 consensus Probab=23.14 E-value=61 Score=14.27 Aligned_cols=40 Identities=18% Similarity=0.218 Sum_probs=27.8 Q ss_pred HHHHHHCCCCHH-HHHHHHHHHCCHHHHHHHHHHHHHHHCC Q ss_conf 676231138767-7889998725668899999999988505 Q gi|254780236|r 50 KLVTLGKKGGLH-SLRLAISKIGDVDVVNKLFGIIAKRYSD 89 (136) Q Consensus 50 klIt~AK~~~~~-~rr~~~~~l~~~~~v~kLf~~l~prf~~ 89 (136) ++.++|+....+ ..+.++..+.+.+.+.-+|++++|++.+ T Consensus 373 rl~~La~~p~aNF~lQrli~h~~~~e~v~~v~eeL~P~~~~ 413 (650) T KOG2188 373 RLDELAVHPIANFPLQRLINHLTSLEDVGSVIEELAPKLSS 413 (650) T ss_pred HHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHH T ss_conf 89998727543425999998656788899999997277999 No 17 >COG5095 TAF6 Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Probab=23.08 E-value=61 Score=14.26 Aligned_cols=31 Identities=19% Similarity=0.314 Sum_probs=12.6 Q ss_pred HHHHHHHHHHHH-HHCCCCHHHHHHHHHHHCC Q ss_conf 998864216762-3113876778899987256 Q gi|254780236|r 42 KELRPIVEKLVT-LGKKGGLHSLRLAISKIGD 72 (136) Q Consensus 42 Kelr~~aEklIt-~AK~~~~~~rr~~~~~l~~ 72 (136) ||+|-|.||+|. ++-..+.+.+.-+.+-|++ T Consensus 193 KELq~YF~kvisal~dEs~~~~r~aAl~sLr~ 224 (450) T COG5095 193 KELQMYFDKVISALLDESDEQTRDAALESLRN 224 (450) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC T ss_conf 99999999999999877789999999987516 No 18 >cd06541 ASCH ASC-1 homology or ASCH domain, a small beta-barrel domain found in all three kingdoms of life. ASCH resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to function as an RNA-binding domain during coactivation, RNA-processing and the regulation of prokaryotic translation. The domain has been named after the ASC-1 protein, the activating signal cointegrator 1 or thyroid hormone receptor interactor protein 4 (TRIP4). ASC-1 is conserved in many eukaryotes and has been suggested to participate in a protein complex that interacts with RNA. It has been shown that ASC-1 mediates the interaction between various transciption factors and the basal transcriptional machinery. Probab=22.55 E-value=63 Score=14.20 Aligned_cols=36 Identities=28% Similarity=0.554 Sum_probs=23.8 Q ss_pred CCCCCEEEEEECCCCCCCCCCEEEEEEECCCCCCCCCCCHHH Q ss_conf 587755998753789998875799995268866222540256 Q gi|254780236|r 89 DRSGGYLRIMKRGFRYGDSAPMAVIEFVDRDLSAKGTPVSRK 130 (136) Q Consensus 89 ~R~GGYTRi~kl~~R~gD~A~ma~iElVd~~~~~~~~~~~~~ 130 (136) -+.|+|-.|+. || -|.|+||+|.-+..+.-+.+.+. T Consensus 31 ~K~G~y~iild-----g~-~pl~~ievv~v~~~~~~~ev~ee 66 (105) T cd06541 31 PKAGDYLIILD-----GQ-QPLAIAEVVKVEIMPMVNELSEE 66 (105) T ss_pred CCCCCEEEEEC-----CC-CCEEEEEEEEEEEEECCCCCCHH T ss_conf 66675789974-----99-96589999889998602413489 No 19 >cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules. Probab=20.94 E-value=68 Score=14.00 Aligned_cols=82 Identities=16% Similarity=0.363 Sum_probs=50.6 Q ss_pred HHHHHHHHHHHHHCCCCHHHHHHHH------HHHCCHHHHHHHHHHHHHHHCCCCCCEEEEEEC-CCCCCCCCCEEEEEE Q ss_conf 9886421676231138767788999------872566889999999998850587755998753-789998875799995 Q gi|254780236|r 43 ELRPIVEKLVTLGKKGGLHSLRLAI------SKIGDVDVVNKLFGIIAKRYSDRSGGYLRIMKR-GFRYGDSAPMAVIEF 115 (136) Q Consensus 43 elr~~aEklIt~AK~~~~~~rr~~~------~~l~~~~~v~kLf~~l~prf~~R~GGYTRi~kl-~~R~gD~A~ma~iEl 115 (136) ++|--+..|+.+||..+..- ++. ..+--+.+..++.+.+. -|+.-.+..-||++. .+|.|..-++++.|. T Consensus 184 QVReca~~L~~~AK~~~i~~--~lVGHVTK~G~iAGPkvLEHmVDtVl-~fEgd~~~~~R~LR~~KNRFG~t~EiGvFeM 260 (372) T cd01121 184 QVRECTAELMRFAKERNIPI--FIVGHVTKEGSIAGPKVLEHMVDTVL-YFEGDRHSEYRILRSVKNRFGSTNELGVFEM 260 (372) T ss_pred HHHHHHHHHHHHHHHCCCEE--EEEEEECCCCCCCCCHHHEEEEEEEE-EECCCCCCCEEEEEEECCCCCCCCEEEEEEE T ss_conf 99999999999998619739--99987626886377403100213688-7515776550356741156777540588873 Q ss_pred ECCCCCCCCCCC Q ss_conf 268866222540 Q gi|254780236|r 116 VDRDLSAKGTPV 127 (136) Q Consensus 116 Vd~~~~~~~~~~ 127 (136) .+.-+..-.+|- T Consensus 261 ~~~GL~~V~nPS 272 (372) T cd01121 261 RENGLREVSNPS 272 (372) T ss_pred CCCCCEECCCHH T ss_conf 168705636856 No 20 >TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein; InterPro: IPR014182 Members of this entry form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases. Some current members of this entry carry designations as putative alginate lyase, however none have been characterised as such.. Probab=20.04 E-value=71 Score=13.89 Aligned_cols=23 Identities=26% Similarity=0.235 Sum_probs=19.4 Q ss_pred HHHHHHHHHHHHHCCEEEECHHH Q ss_conf 99999999999868937875999 Q gi|254780236|r 18 KAMFSNMAASIIWHEQIVTTLPK 40 (136) Q Consensus 18 ~allrnl~~~Li~herI~TT~~K 40 (136) .+-|=|=|..||-.|+|.||++. T Consensus 285 QH~LLn~VA~LvD~G~irTTl~e 307 (338) T TIGR02817 285 QHELLNRVARLVDAGKIRTTLAE 307 (338) T ss_pred HHHHHHHHHHHHCCCEEEEEECC T ss_conf 99999999888649846531103 Done!