HHsearch alignment of GI: 254780236 and MMDB domain: 3bbo_P_

>3bbo_P (P:) Ribosomal protein L17; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Nicotiana tabacum}
Probab=100.00  E-value=0  Score=327.21  Aligned_cols=116  Identities=40%  Similarity=0.662  Sum_probs=115.6

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEECHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCHHHHHHHH
Q ss_conf             99888899999788999999999999998689378759999998864216762311387677889998725668899999
Q gi|254780236|r    1 MRHAISGRKLNRTSSHRKAMFSNMAASIIWHEQIVTTLPKAKELRPIVEKLVTLGKKGGLHSLRLAISKIGDVDVVNKLF   80 (136)
Q Consensus         1 MrH~~~~rklgr~~~hR~allrnl~~~Li~herI~TT~~KAKelr~~aEklIt~AK~~~~~~rr~~~~~l~~~~~v~kLf   80 (136)
                      |||+++++||||+++||++|||||+++||+||||+||++||||+|+|||+|||+||+|++|++|++.+||.|+++++|||
T Consensus        90 MrH~~k~rKLgR~~shR~aLLRnLvTsLI~heRIeTT~aKAKElR~~aEkLITlAK~g~~harR~a~~~L~dk~lv~KLF  169 (205)
T 3bbo_P           90 MRHGRKVPKLNRPPDQRRALLRGLTTQLLKHGRIKTTKARARAVRKYVDKMITMAKDGSLHKRRQALGFIYEKQIVHALF  169 (205)
T ss_dssp             CCTTCCSCCTTSCGGGHHHHHHHHHHHHHHTSCEEECHHHHHHHHHHHHHHHHHHHHCTTHHHHHHHTTCCCTTHHHHHT
T ss_pred             ECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEECHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             22787678899885999999999999999769799658989888888999987612345778899998565589999999


Q ss_pred             HHHHHHHCCCCCCEEEEEECCCCCCCCCCEEEEEEE
Q ss_conf             999988505877559987537899988757999952
Q gi|254780236|r   81 GIIAKRYSDRSGGYLRIMKRGFRYGDSAPMAVIEFV  116 (136)
Q Consensus        81 ~~l~prf~~R~GGYTRi~kl~~R~gD~A~ma~iElV  116 (136)
                      ++|+|||+|||||||||+|+++|.||+|+||+||||
T Consensus       170 ~eiapRY~dR~GGYTRIiKl~~R~GD~A~MAiIELV  205 (205)
T 3bbo_P          170 AEVPDRYGERNGGYTRIIRTLPRRGDNAPMAYIELV  205 (205)
T ss_dssp             TSSGGGGSSCCSCCEECCBCSCCSSSCCCCEEEEEC
T ss_pred             HHHHHHHCCCCCCEEEEEECCCCCCCCCCEEEEEEC
T ss_conf             998798677998846678788999998886899859