BLAST/PSIBLAST alignment of GI: 254780236 and GI: 163760825 at iteration 1
>gi|163760825|ref|ZP_02167904.1| 50S ribosomal protein L17 [Hoeflea phototrophica DFL-43] Length = 142
>gi|162281869|gb|EDQ32161.1| 50S ribosomal protein L17 [Hoeflea phototrophica DFL-43] Length = 142
 Score =  197 bits (501), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 95/124 (76%), Positives = 107/124 (86%)

Query: 1   MRHAISGRKLNRTSSHRKAMFSNMAASIIWHEQIVTTLPKAKELRPIVEKLVTLGKKGGL 60
           MRH  SGRKLNRTSSHRKAMF+NMAAS+I HEQIVTTLPKAKE+RPIVEKLVTLGK+G L
Sbjct: 1   MRHGNSGRKLNRTSSHRKAMFANMAASLIEHEQIVTTLPKAKEIRPIVEKLVTLGKRGDL 60

Query: 61  HSLRLAISKIGDVDVVNKLFGIIAKRYSDRSGGYLRIMKRGFRYGDSAPMAVIEFVDRDL 120
           H+ R AIS+I D D V KLF  IA RY+ R+GGY+RIMK GFR GD+APMAV+EFVDRD+
Sbjct: 61  HARRQAISQIRDNDAVRKLFDTIATRYATRNGGYIRIMKAGFRTGDNAPMAVVEFVDRDV 120

Query: 121 SAKG 124
            AKG
Sbjct: 121 DAKG 124