HHsearch alignment for GI: 254780237 and conserved domain: cd06926

>cd06926 RNAP_II_RPB11 RPB11 subunit of Eukaryotic RNA polymerase II. The eukaryotic RPB11 subunit of RNA polymerase (RNAP) II is involved in the assembly of RNAP subunits. RNAP is a large multi-subunit complex responsible for the synthesis of RNA. It is the principal enzyme of the transcription process, and is a final target in many regulatory pathways that control gene expression in all living cells. At least three distinct RNAP complexes are found in eukaryotic nuclei: RNAP I, RNAP II, and RNAP III. RNAP II is responsible for the synthesis of mRNA precursor. The RPB11 subunit heterodimerizes with the RPB3 subunit, and together with RPB10 and RPB12, anchors the two largest subunits, RPB1 and RPB2, and stabilizes their association.
Probab=93.58  E-value=0.23  Score=29.08  Aligned_cols=47  Identities=28%  Similarity=0.360  Sum_probs=35.1

Q ss_pred             EEEEEEEEEEECCCCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             44223577641168877621899999938961777999999999999888762
Q gi|254780237|r  180 IKKVSYTVESAREGQVLDYDKLSMTIDTDGSITGEDSVALASRILQDQLGMFI  232 (340)
Q Consensus       180 V~~Vny~Ve~~rvg~~t~~dkL~lEI~TnGsi~P~eAl~~Aa~iL~~~l~~f~  232 (340)
T Consensus        44 v~fagY~~pHPl------~~~i~lriqT~~~~~p~~aL~~al~~L~~~~~~l~   90 (93)
T cd06926          44 VLFAGYKVPHPL------EHKIELRIQTDGSITPKEALKNAITDLISELSLLK   90 (93)
T ss_pred             CEEEEECCCCCC------CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             569775178998------77058999979999999999999999999999998