HHsearch results for GI: 254780237 and protein with PDBid: 2pa8_D

>2pa8_D DNA-directed RNA polymerase subunit D; ferredoxin-like Fe-S binding motif, platform for RNA polymerase assembly, transferase; 1.76A {Sulfolobus solfataricus P2} PDB: 2pmz_D 3hkz_D 2waq_D 2wb1_D
Probab=100.00  E-value=1e-36  Score=256.56  Aligned_cols=208  Identities=17%  Similarity=0.155  Sum_probs=177.6

Q ss_pred             CCCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEEEEE---------CCCCCCCCCCCCCHHHHHHHHHHHCCC
Q ss_conf             78881589999616975667888999998741698306889998---------871443146646244499999840114
Q gi|254780237|r   22 QEEENRTLMIAEPLPRGFAHTLGNALRRVLMSSLRGAAITAVQI---------DGVLHEISSIKGVHEDLTDIILNIKGI   92 (340)
Q Consensus        22 ~~~~~~g~f~~~Ple~G~g~TlGNaLRRvLLssi~G~ait~vkI---------~gv~HEfs~i~GV~EDV~eIiLNLK~I   92 (340)
                      +.++++.+|.+.    |+|.|+||||||+|||++||+||++|+|         +++.|+|+.||++.|++.++++|+|.+
T Consensus         7 ~~~~~~~~f~~~----g~~~si~NaLRR~lls~ip~~ai~~v~I~~Nts~~~dE~i~hrl~lIP~~~e~~~~~~~~~~~~   82 (265)
T 2pa8_D            7 HKDDTRIDLVFE----GYPLEFVNAIRRASMLYVPIMAVDDVYFIENNSPLYDEILAHRLALIPFMSEEALDTYRWPEEC   82 (265)
T ss_dssp             EECSSEEEEEEE----SSCHHHHHHHHHHHHHSCCEEEEEEEEEEEECSSSCHHHHHHHHTTSCBCCTTHHHHSCCGGGC
T ss_pred             ECCCCEEEEEEE----CCCCHHHHHHHHHHHHCCCEEEEEEEEEEECCCCCCCCCCEEEEECCCCCCCCCHHHHCCCHHE
T ss_conf             737988999997----8882799999999997496367999999866654667750689851675013502321160210


Q ss_pred             EEEECCCC--CEEEEEE---EECCEEEEEEEEECC-CCEEEECCCEEEEEECCCCEEEEEEEEECCCCCEECCCCCC---
Q ss_conf             17772798--2799999---944716996335138-98599888808999778964999999746876320344446---
Q gi|254780237|r   93 NLKMSGDS--HKRVTIF---KRGPGVVTAGDIQTV-NDIEVLNPDHVICNLDVDAVVRMELTVSKGHGYVPAKHHRT---  163 (340)
Q Consensus        93 ~~k~~~~~--~~~~~l~---~~Gp~~vtA~Di~~p-~~veivNpd~~IaTl~~~~~l~iel~ie~G~GY~~~e~~~~---  163 (340)
                      ........  ....++.   ..||+.++|+|++.+ +.+++++|+++||+|..+..|.+++++..|+|+..+..+..   
T Consensus        83 ~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~di~~~~~~~~~~~~~i~I~~L~~~q~L~l~~~~~~g~Gk~hak~~~v~~~  162 (265)
T 2pa8_D           83 IECTENCEKCYTKIYIEAEAPNEPRMIYSKDIKSEDPSVVPISGDIPIVLLGTNQKISLEARLRLGYGKEHAKFIPVSLS  162 (265)
T ss_dssp             TTCCSSCTTTEEEEEEEEECCSSCEEEEGGGCEESSTTCCBSCSCCEEEEECTTCEEEEEEEEEEECTTTCGGGCCEEEE
T ss_pred             EECCCCCCCEEEEEEEEEECCCCCCEEEHHHCCCCCCCCCCCCCCCEEEECCCCCEEEEEEEEEEEECCCCCCCCCCCCC
T ss_conf             22158898238999998882789837873332467997221148806999379976778999996364212212766543


Q ss_pred             --------------------------CCCCCCEECCCCCHHEEEEEEEEEEEECCCCCCCCCEEEEEEEECCCCCHHHHH
Q ss_conf             --------------------------557543021243111144223577641168877621899999938961777999
Q gi|254780237|r  164 --------------------------ENDPIGLITIDALYSPIKKVSYTVESAREGQVLDYDKLSMTIDTDGSITGEDSV  217 (340)
Q Consensus       164 --------------------------~~~~ig~i~iDa~FsPV~~Vny~Ve~~rvg~~t~~dkL~lEI~TnGsi~P~eAl  217 (340)
                                                ........+.|+.++|+.+++|...+..+....++++++|+|||+|+++|++|+
T Consensus       163 ~y~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~f~f~IET~G~i~p~~il  242 (265)
T 2pa8_D          163 VVRYYPKVEILANCEKAVNVCPEGVFELKDGKLSVKNELSCTLCEECLRYCNGSIRISFVEDKYILEIESVGSLKPERIL  242 (265)
T ss_dssp             EEEEEEEEEECSCCTTHHHHCTTCCEEEETTEEEESCGGGCCCCCHHHHHHTTSEEEEEEEEEEEEEEEECSSSCHHHHH
T ss_pred             CCCCCCCHHHHCCHHHHHHHCCCCCCCCCCCCEEECCCHHCCEEEEEEEECCCCEEECCCCCEEEEEEEECCCCCHHHHH
T ss_conf             31213404330004677664732430125675267452328714676542575200033676899999974761999999


Q ss_pred             HHHHHHHHHHHHHHHC
Q ss_conf             9999999998887622
Q gi|254780237|r  218 ALASRILQDQLGMFIN  233 (340)
Q Consensus       218 ~~Aa~iL~~~l~~f~~  233 (340)
                      .+|+++|+++|..|.+
T Consensus       243 ~~A~~iL~~kl~~l~~  258 (265)
T 2pa8_D          243 LEAGKSIIRKIEELEK  258 (265)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999999