Score = 87.4 bits (217), Expect = 1e-18 Identities = 21/65 (32%), Positives = 29/65 (44%) Query: 253 NPALLKKVEELELSVRSTNCLRGENIVYMGDLIQRTEADMLRMANFGRKSLVEIKGVLGT 312 L +EEL LS R + L+ E I + L+ D+ + G +SL EIK L Sbjct: 3 EEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEK 62 Query: 313 MGLFL 317 G L Sbjct: 63 KGFTL 67
class: All alpha proteins
fold: SAM domain-like
superfamily: C-terminal domain of RNA polymerase alpha subunit
family: C-terminal domain of RNA polymerase alpha subunit
domain: C-terminal domain of RNA polymerase alpha subunit
species: Thermus thermophilus [TaxId: 274]