Score = 55.7 bits (134), Expect = 5e-09 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 8/70 (11%) Query: 23 EEENRTLM--IAEPLPRGFAHTLGNALRRVLMSSLRGAAITAVQIDGVLHEISSIKGVHE 80 + R + EPL RGF TLGN LRR+L+SS+ A Q++ + G Sbjct: 14 RTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPPVRRVAFQVE------DTRLGQRT 67 Query: 81 DLTDIILNIK 90 DL + L I Sbjct: 68 DLDKLTLRIW 77
class: Alpha and beta proteins (a+b)
fold: DCoH-like
superfamily: RBP11-like subunits of RNA polymerase
family: RNA polymerase alpha subunit dimerisation domain
domain: RNA polymerase alpha
species: Thermus thermophilus [TaxId: 274]