HHsearch alignment for GI: 254780238 and conserved domain: COG0256

>COG0256 RplR Ribosomal protein L18 [Translation, ribosomal structure and biogenesis].
Probab=95.78  E-value=0.12  Score=30.95  Aligned_cols=90  Identities=18%  Similarity=0.145  Sum_probs=66.0

Q ss_pred             CEEEEEEECCCCEEEEEECCCC-CEEEEECCCCCCCCC--C--CCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCC-
Q ss_conf             2189999179877999970899-889974044435577--5--433520378999999999998698199999977998-
Q gi|254780238|r   18 SGRAHVVSTFNNTRITITDPHG-NTIAWSSPKVVGFSG--S--RKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGA-   91 (129)
Q Consensus        18 ~GiihI~~t~NNTiitlTd~~G-n~i~~~S~G~~gfkg--~--kk~t~~Aa~~~a~~~~~~~~~~gi~~v~v~ikG~G~-   91 (129)
T Consensus        29 rpRL~V~rSnkhi~aQiId~~~~~tla~aSt~~~~l~~~g~~~~~~N~~aA~~vG~lia~ra~~kgi~~vVfdr~g~~yh  108 (125)
T COG0256          29 RPRLVVRRSNRHIYAQIIDDVKGGTLASASTLSKELRKYGKKGGGGNTEAAYLVGKLIAERALAKGIEEVVFDRGGYKYH  108 (125)
T ss_pred             CCEEEEEEECCCEEEEEEECCCCCEEEEEECCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCC
T ss_conf             95799998089389999974899669998713677764032578987899999999999999985995899838988651


Q ss_pred             CH-HHHHHHHHHCCCEE
Q ss_conf             67-88877876369369
Q gi|254780238|r   92 GR-DSALRALRAIGFTI  107 (129)
Q Consensus        92 GR-~~~ik~l~~~glkI  107 (129)
T Consensus       109 gRV~Ala~~AreaGL~f  125 (125)
T COG0256         109 GRVAALADGAREAGLEF  125 (125)
T ss_pred             HHHHHHHHHHHHCCCCC
T ss_conf             19999999999729679