HHsearch alignment for GI: 254780238 and conserved domain: KOG0408

>KOG0408 consensus.
Probab=100.00  E-value=3.4e-39  Score=260.70  Aligned_cols=120  Identities=45%  Similarity=0.744  Sum_probs=115.9

Q ss_pred             CCCCEEEECCCEEEEEEECCCCEEEEEECCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEE
Q ss_conf             33430012252189999179877999970899889974044435577543352037899999999999869819999997
Q gi|254780238|r    8 IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVS   87 (129)
Q Consensus         8 ~~~k~~~~i~~GiihI~~t~NNTiitlTd~~Gn~i~~~S~G~~gfkg~kk~t~~Aa~~~a~~~~~~~~~~gi~~v~v~ik   87 (129)
T Consensus        71 ~~g~~f~eiP--i~hIraS~NNTivtVtd~kg~vi~~~ScgteGFrntrkgT~iAaQtaavaa~~r~v~~G~~~vrV~Vk  148 (190)
T KOG0408          71 FSGKNFREIP--IIHIRASFNNTIVTVTDVKGEVISWSSCGTEGFRNTRKGTPIAAQTAAVAAIRRAVDQGMQTVRVRVK  148 (190)
T ss_pred             CCCCCCCCCC--EEEEEECCCCEEEEEECCCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEEEEEE
T ss_conf             4786213054--68998537870899980688489885024201235666885067777789999999716369999984


Q ss_pred             CCCCCHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCCC
Q ss_conf             799867888778763693699999638898888688886789
Q gi|254780238|r   88 GLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI  129 (129)
Q Consensus        88 G~G~GR~~~ik~l~~~glkI~~I~D~T~ip~nGcRp~K~RRi  129 (129)
T Consensus       149 GlGpGRmsa~kgl~m~Gl~vvsItD~Tp~~~ng~RPrK~Rrl  190 (190)
T KOG0408         149 GLGPGRMSALKGLRMGGLLVVSITDNTPMPHNGCRPRKKRRL  190 (190)
T ss_pred             CCCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCCCCCC
T ss_conf             588647888765521556999960688688789996412469