HHsearch alignment for GI: 254780238 and conserved domain: cd00432

>cd00432 Ribosomal_L18_L5e Ribosomal L18/L5e: L18 (L5e) is a ribosomal protein found in the central protuberance (CP) of the large subunit. L18 binds 5S rRNA and induces a conformational change that stimulates the binding of L5 to 5S rRNA. Association of 5S rRNA with 23S rRNA depends on the binding of L18 and L5 to 5S rRNA. L18/L5e is generally described as L18 in prokaryotes and archaea, and as L5e (or L5) in eukaryotes. In bacteria, the CP proteins L5, L18, and L25 are required for the ribosome to incorporate 5S rRNA into the large subunit, one of the last steps in ribosome assembly. In archaea, both L18 and L5 bind 5S rRNA; in eukaryotes, only the L18 homolog (L5e) binds 5S rRNA but a homolog to L5 is also identified.
Probab=97.60  E-value=0.001  Score=43.64  Aligned_cols=88  Identities=19%  Similarity=0.197  Sum_probs=69.1

Q ss_pred             CEEEEEEECCCCEEEEEECCC-CCEEEEECCCCCCCCCC--CCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCC-CH
Q ss_conf             218999917987799997089-98899740444355775--433520378999999999998698199999977998-67
Q gi|254780238|r   18 SGRAHVVSTFNNTRITITDPH-GNTIAWSSPKVVGFSGS--RKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGA-GR   93 (129)
Q Consensus        18 ~GiihI~~t~NNTiitlTd~~-Gn~i~~~S~G~~gfkg~--kk~t~~Aa~~~a~~~~~~~~~~gi~~v~v~ikG~G~-GR   93 (129)
T Consensus        11 ~pRl~V~~Snk~i~aqiid~~~~~tl~sasT~~~~~~~~~~~~~n~~aA~~vG~~la~r~~~~gi~~vvfDrg~~~yhgr   90 (103)
T cd00432          11 RPRLVVRKSNKHIYAQIIDDSGDKTLVSASTLELAIKGVLGSGNNVEAAYLVGRLLAKRALEKGIKKVVFDRGGYRYHGR   90 (103)
T ss_pred             CCEEEEEEECCEEEEEEEECCCCCEEEEEECCHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHH
T ss_conf             98899998189389999985999599999714065531236886299999999999999998799889986799976379


Q ss_pred             -HHHHHHHHHCCC
Q ss_conf             -888778763693
Q gi|254780238|r   94 -DSALRALRAIGF  105 (129)
Q Consensus        94 -~~~ik~l~~~gl  105 (129)
T Consensus        91 v~a~a~~~re~Gl  103 (103)
T cd00432          91 VKALAKGAREGGL  103 (103)
T ss_pred             HHHHHHHHHHCCC
T ss_conf             9999999998589