HHsearch alignment of GI: 254780238 and MMDB domain: 1vq8_N_

>1vq8_N (N:) 50S ribosomal protein L18P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui}
Probab=97.22  E-value=0.0031  Score=40.24  Aligned_cols=98  Identities=15%  Similarity=0.126  Sum_probs=76.3

Q ss_pred             CEEEEEEECCCCEEEEEE--CCCC-CEEEEECCCCCCCCCCCC--CCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCC--
Q ss_conf             218999917987799997--0899-889974044435577543--352037899999999999869819999997799--
Q gi|254780238|r   18 SGRAHVVSTFNNTRITIT--DPHG-NTIAWSSPKVVGFSGSRK--NSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLG--   90 (129)
Q Consensus        18 ~GiihI~~t~NNTiitlT--d~~G-n~i~~~S~G~~gfkg~kk--~t~~Aa~~~a~~~~~~~~~~gi~~v~v~ikG~G--   90 (129)
                      ...+-|..|.+++++.+.  |..| .+++.+|+-.+..++...  ...-||+.++..+++++.+.|+..+..-+-++.  
T Consensus        32 k~RLvVr~TNr~i~aQIv~~d~~gd~vlasAsS~El~~~g~~~~~~N~~AAy~vG~llA~Ral~~gi~~~vlD~G~~~~~  111 (187)
T 1vq8_N           32 KPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPT  111 (187)
T ss_dssp             SCEEEEEECSSCEEEEEEECCTTSCEEEEEEESGGGGGGTCCSCSSSHHHHHHHHHHHHHHHHHTTCCBCEEECTTSCCC
T ss_pred             CCEEEEEEECCCEEEEEEEECCCCCEEEEEEEHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             97699999478079999983389997999987113555222158627789999999999999850356058731777787


Q ss_pred             C-CH-HHHHHHHHHCCCEEEEEEECCCCCCCCCCCC
Q ss_conf             8-67-8887787636936999996388988886888
Q gi|254780238|r   91 A-GR-DSALRALRAIGFTIVSICDVTMIAHNGCRPR  124 (129)
Q Consensus        91 ~-GR-~~~ik~l~~~glkI~~I~D~T~ip~nGcRp~  124 (129)
                      . || .++++++...||+         +||+-.+-|
T Consensus       112 ~ggrV~A~~kga~d~Gl~---------iph~~~~~p  138 (187)
T 1vq8_N          112 PGSKVFAIQEGAIDAGLD---------IPHNDDVLA  138 (187)
T ss_dssp             TTCHHHHHHHHHHHTTCB---------CCCCGGGSC
T ss_pred             CCCHHHHHHHHHHHCCCC---------CCCCCCCCC
T ss_conf             674099899999966926---------788876588