Query         gi|254780238|ref|YP_003064651.1| 30S ribosomal protein S11 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 129
No_of_seqs    107 out of 1080
Neff          5.7 
Searched_HMMs 33803
Date          Tue May 24 00:11:54 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780238.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >3i1m_K 30S ribosomal protein  100.0       0       0  310.9  10.5  129    1-129     1-129 (129)
  2 >2vqe_K 30S ribosomal protein  100.0 1.4E-45       0  301.0  14.8  123    6-128     4-126 (129)
  3 >3bbn_K Ribosomal protein S11; 100.0 1.4E-45       0  301.0  10.9  123    7-129    18-140 (140)
  4 >1s1h_K RP59A, 40S ribosomal p 100.0 5.6E-43       0  283.5  13.4  122    7-128     2-132 (136)
  5 >2zkq_k 40S ribosomal protein  100.0 8.9E-43       0  282.2   9.9  120    9-128    19-147 (151)
  6 >1vq8_N 50S ribosomal protein   97.2  0.0031 9.3E-08   40.2   8.9   98   18-124    32-138 (187)
  7 >1ovy_A 50S ribosomal protein   97.2 0.00051 1.5E-08   45.1   4.4   92   16-107    26-120 (120)
  8 >3i1n_O 50S ribosomal protein   97.0  0.0053 1.6E-07   38.9   8.4   90   17-106    22-116 (117)
  9 >3bbo_Q Ribosomal protein L18;  96.6  0.0016 4.6E-08   42.1   2.9   89   18-106    65-160 (161)
 10 >2j01_S 50S ribosomal protein   96.4  0.0014 4.2E-08   42.3   1.9   87   17-106    22-111 (112)
 11 >2zjr_L 50S ribosomal protein   96.2  0.0048 1.4E-07   39.1   3.6   84   19-106     5-91  (92)
 12 >3jyw_E 60S ribosomal protein   94.1   0.021 6.3E-07   35.2   1.7  101   16-125    36-172 (237)
 13 >2zkr_n 60S ribosomal protein   76.4       6 0.00018   20.2   9.7  101   15-125    45-182 (297)
 14 >1gad_O D-glyceraldehyde-3-pho  72.9     4.2 0.00012   21.1   3.6   36   81-117     1-38  (165)
 15 >3e5r_O PP38, glyceraldehyde-3  68.9     5.1 0.00015   20.6   3.3   37   79-115     1-39  (173)
 16 >2tmg_A Protein (glutamate deh  67.6     5.3 0.00016   20.5   3.2   66   53-119    34-100 (267)
 17 >3hja_A GAPDH, glyceraldehyde-  62.3     7.8 0.00023   19.5   3.2   41   76-116    16-56  (189)
 18 >3cmc_O GAPDH, glyceraldehyde-  61.7      10 0.00031   18.7   3.7   35   82-116     2-37  (171)
 19 >2i5p_O GAPDH 1, glyceraldehyd  60.8     9.3 0.00028   19.0   3.4   40   77-116    10-51  (176)
 20 >2b4r_O Glyceraldehyde-3-phosp  60.0     9.3 0.00028   19.0   3.3   40   76-115     6-47  (179)
 21 >2ep7_A GAPDH, glyceraldehyde-  56.1      12 0.00035   18.4   3.2   35   81-116     2-38  (171)
 22 >3kws_A Putative sugar isomera  53.9      14 0.00042   17.9   3.4   47   67-113    40-86  (287)
 23 >3cps_A Glyceraldehyde 3-phosp  51.9      14 0.00042   17.9   3.1   36   79-115    15-53  (188)
 24 >2yyy_A Glyceraldehyde-3-phosp  51.8      18 0.00053   17.2   4.4   35   81-116     2-38  (177)
 25 >2g82_O GAPDH, glyceraldehyde-  49.6      16 0.00048   17.5   3.1   35   82-116     1-35  (168)
 26 >1u8f_O GAPDH, glyceraldehyde-  42.7      24 0.00071   16.5   3.1   34   80-113     2-36  (171)
 27 >2czc_A Glyceraldehyde-3-phosp  41.7      26 0.00077   16.3   4.2   34   82-116     3-38  (174)
 28 >1gtm_A Glutamate dehydrogenas  38.8      29 0.00085   16.0   3.8   63   57-119     6-69  (211)
 29 >3g9k_S Capsule biosynthesis p  38.2      29 0.00087   15.9   3.4   24   30-53      2-25  (141)
 30 >3h9e_A Glyceraldehyde-3-phosp  37.0      31 0.00091   15.8   3.4   36   80-115     6-42  (181)
 31 >3l6b_A Serine racemase; pyrid  33.7      35   0.001   15.5   4.3   55   37-110     2-56  (82)
 32 >2dkj_A Serine hydroxymethyltr  32.7      36  0.0011   15.4   4.6   52   60-111    37-99  (163)
 33 >2v36_B Gamma-glutamyltranspep  31.9      37  0.0011   15.3   3.3   18   30-47      2-19  (193)
 34 >1hwx_A GDH, glutamate dehydro  31.1      38  0.0011   15.2   2.8   38   81-118     3-40  (131)
 35 >2jvf_A De novo protein M7; te  30.1      40  0.0012   15.1   4.1   28   62-89     61-88  (96)
 36 >1qys_A TOP7; alpha-beta, nove  29.7      41  0.0012   15.1   4.5   28   62-89     59-86  (106)
 37 >1v9l_A Glutamate dehydrogenas  28.3      43  0.0013   14.9   4.7   68   50-118     4-71  (219)
 38 >2hpi_A DNA polymerase III alp  27.4      14 0.00041   17.9  -0.2   47   62-119   108-154 (157)
 39 >1rv3_A Serine hydroxymethyltr  26.1      47  0.0014   14.7   5.0   62   61-122    35-110 (192)
 40 >3l23_A Sugar phosphate isomer  25.2      49  0.0014   14.6   5.3   50   65-114    29-82  (303)
 41 >2dsc_A ADP-sugar pyrophosphat  24.3      51  0.0015   14.5   2.5   19   31-49     35-53  (58)
 42 >1vl6_A Malate oxidoreductase;  23.3      53  0.0016   14.4   4.9   55   67-121    11-65  (156)
 43 >2hnh_A DNA polymerase III alp  22.5      19 0.00055   17.2  -0.3   47   62-119    62-108 (112)
 44 >2vi8_A Serine hydroxymethyltr  22.4      55  0.0016   14.3   4.8   51   61-111    38-99  (162)
 45 >3klj_A NAD(FAD)-dependent deh  22.2      56  0.0017   14.2   3.1   42   82-123    10-51  (169)
 46 >3ju2_A Uncharacterized protei  21.7      39  0.0011   15.2   1.2   41   70-110    24-65  (284)
 47 >1now_A Beta-hexosaminidase be  21.7      57  0.0017   14.2   2.8   63   28-91     33-95  (319)
 48 >3l8k_A Dihydrolipoyl dehydrog  21.5      25 0.00074   16.4   0.2   34   81-114     4-37  (183)
 49 >1l1q_A Adenine phosphoribosyl  21.1      59  0.0017   14.1   2.8   55   63-119   129-186 (186)

No 1  
>>3i1m_K 30S ribosomal protein S11; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_K* 3e1a_C 3e1c_C 1vs5_K 3i1o_K 3i1q_K 3i1s_K 3i1z_K 3i21_K 2qal_K* 1p6g_K 1p87_K 2aw7_K 2avy_K 2i2u_K 2i2p_K* 2qan_K* 2qb9_K* 2qbb_K* 2qbd_K ... (K:)
Probab=100.00  E-value=0  Score=310.92  Aligned_cols=129  Identities=52%  Similarity=0.897  Sum_probs=128.0

Q ss_pred             CCCCCCCCCCCEEEECCCEEEEEEECCCCEEEEEECCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             98876443343001225218999917987799997089988997404443557754335203789999999999986981
Q gi|254780238|r    1 MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMS   80 (129)
Q Consensus         1 m~~~~~~~~~k~~~~i~~GiihI~~t~NNTiitlTd~~Gn~i~~~S~G~~gfkg~kk~t~~Aa~~~a~~~~~~~~~~gi~   80 (129)
                      |+++..+++++++++++.|++||++|+|||||||||++|++++|+|+|++||||++|+|+|||+++++.++++++++||+
T Consensus         1 ma~~~~~~~~~~~~~~~~giihI~~s~NNT~vt~Td~~g~~~~~~S~G~~GfK~~rk~t~~Aa~~~a~~~~~~~~~~Gi~   80 (129)
T 3i1m_K            1 MAKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCADAVKEYGIK   80 (129)
T ss_dssp             ------------CCCCSEEEEEEEECSSCEEEEEEETTCCCCEEEETGGGSCCGGGTTSHHHHHHHHHHHHTTTGGGCCC
T ss_pred             CCCCCCCCCCCCCCCCCCCEEEEEECCCCEEEEEECCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCE
T ss_conf             98887555454243156618999923787899998699998889843443226754443679999999999999982982


Q ss_pred             EEEEEEECCCCCHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCCC
Q ss_conf             9999997799867888778763693699999638898888688886789
Q gi|254780238|r   81 SLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI  129 (129)
Q Consensus        81 ~v~v~ikG~G~GR~~~ik~l~~~glkI~~I~D~T~ip~nGcRp~K~RRi  129 (129)
                      .|+|+++|+|+||+++|++|..+||+|.+|.|+||+|||||||||+|||
T Consensus        81 ~v~v~~kG~G~gr~~ai~~l~~~glkI~~I~D~T~iphnGcRp~K~RRv  129 (129)
T 3i1m_K           81 NLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV  129 (129)
T ss_dssp             EEEEEEESSSTTSSHHHHHHHTTTCCCCEEEBCCCCCSSCSCCCCCCCC
T ss_pred             EEEEEEECCCCCHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCC
T ss_conf             9999997977861777546524898898989899999999897989899


No 2  
>>2vqe_K 30S ribosomal protein S11, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} (K:)
Probab=100.00  E-value=1.4e-45  Score=301.03  Aligned_cols=123  Identities=49%  Similarity=0.823  Sum_probs=118.4

Q ss_pred             CCCCCCEEEECCCEEEEEEECCCCEEEEEECCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             44334300122521899991798779999708998899740444355775433520378999999999998698199999
Q gi|254780238|r    6 SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVK   85 (129)
Q Consensus         6 ~~~~~k~~~~i~~GiihI~~t~NNTiitlTd~~Gn~i~~~S~G~~gfkg~kk~t~~Aa~~~a~~~~~~~~~~gi~~v~v~   85 (129)
                      ....++.++.++.|++||++|+|||||||||++||+++|+|+|++||||++|+|+|||+++++.++++++++||+.|+|+
T Consensus         4 ~~~~~k~~~~~~~~iihI~st~NNT~itlTd~~g~~~~~~S~G~~Gfkg~rk~t~~Aa~~aa~~~~~~~~~~gi~~v~i~   83 (129)
T 2vqe_K            4 KPSKKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVI   83 (129)
T ss_dssp             -------CCCCSEEEEEEEECSSCEEEEEECTTSCEEEECCTTTTTCCSGGGGSHHHHHHHHHHHHHHHHTTTCCEEEEE
T ss_pred             CCCCCCCCEECCCCEEEEEECCCCEEEEEECCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEE
T ss_conf             77776553573367899994469889999869999999984243565675555467899999999999998197099999


Q ss_pred             EECCCCCHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCC
Q ss_conf             9779986788877876369369999963889888868888678
Q gi|254780238|r   86 VSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR  128 (129)
Q Consensus        86 ikG~G~GR~~~ik~l~~~glkI~~I~D~T~ip~nGcRp~K~RR  128 (129)
                      ++|+|+||+++|++|...||+|.+|+|+||+|||||||||+||
T Consensus        84 ikG~G~gr~~aik~l~~~glkI~~I~D~TpiphnGcRp~K~RR  126 (129)
T 2vqe_K           84 VRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR  126 (129)
T ss_dssp             EESCCTTHHHHHHHHHTSSSEEEECEECCCCCSSCSCCCGGGC
T ss_pred             EECCCCCHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCC
T ss_conf             9877787078840865388789999988999989989898887


No 3  
>>3bbn_K Ribosomal protein S11; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} (K:)
Probab=100.00  E-value=1.4e-45  Score=300.99  Aligned_cols=123  Identities=41%  Similarity=0.735  Sum_probs=118.8

Q ss_pred             CCCCCEEEECCCEEEEEEECCCCEEEEEECCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEE
Q ss_conf             43343001225218999917987799997089988997404443557754335203789999999999986981999999
Q gi|254780238|r    7 RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKV   86 (129)
Q Consensus         7 ~~~~k~~~~i~~GiihI~~t~NNTiitlTd~~Gn~i~~~S~G~~gfkg~kk~t~~Aa~~~a~~~~~~~~~~gi~~v~v~i   86 (129)
                      ...++.++.++.|++||++|+|||||||||++||+++|+|+|++||+|++|+|+|||+++++.++++|+++||+.|+|++
T Consensus        18 ~~~~~~~~~~~~giihI~~t~NNT~itlTd~~g~~~~~~S~G~~gfk~~~k~t~~Aa~~~a~~~~~k~~~~gi~~v~i~~   97 (140)
T 3bbn_K           18 SRKSASARKIPKGVIHVQASFNNTIVTVTDVRGRVVSWASAGTCGFRGTKRGTPFAAQTAAGNAIRTVVEQGMQRAEVMI   97 (140)
T ss_dssp             -----CCCCCCCCEEEEEECSSCEEEEEECSSSCEEEEEETTTSSCCTTSCSSHHHHHHHHTSGGGTSTTTCCCEEEEEE
T ss_pred             CCCCCCCCCCCCEEEEEEECCCCEEEEEECCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEEE
T ss_conf             23135442155459999904797899996599998999834322446755341757999999999999980982999999


Q ss_pred             ECCCCCHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCCC
Q ss_conf             7799867888778763693699999638898888688886789
Q gi|254780238|r   87 SGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI  129 (129)
Q Consensus        87 kG~G~GR~~~ik~l~~~glkI~~I~D~T~ip~nGcRp~K~RRi  129 (129)
                      +|+|+||++++++|...|++|.+|+|+||+|||||||||+|||
T Consensus        98 kG~G~gr~~~i~~l~~~gl~I~~I~D~T~ip~nGcR~~K~RRi  140 (140)
T 3bbn_K           98 KGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGCRPPKKRRV  140 (140)
T ss_dssp             ESCSTTSSHHHHHHHTTTCEEEEEEECCCCCCSCCCCCCCCCC
T ss_pred             ECCCCCHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCC
T ss_conf             4477873464101014898788999899999999898989899


No 4  
>>1s1h_K RP59A, 40S ribosomal protein S14-A; 80S ribosome, 40S ribosomal subunit, EEF2, tRNA translocation, sordarin, cryo-EM; 11.70A {Saccharomyces cerevisiae} (K:)
Probab=100.00  E-value=5.6e-43  Score=283.48  Aligned_cols=122  Identities=30%  Similarity=0.450  Sum_probs=116.8

Q ss_pred             CCCCCEEEECCCEEEEEEECCCCEEEEEECCCCCEE-EEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             433430012252189999179877999970899889-9740444355775433520378999999999998698199999
Q gi|254780238|r    7 RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTI-AWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVK   85 (129)
Q Consensus         7 ~~~~k~~~~i~~GiihI~~t~NNTiitlTd~~Gn~i-~~~S~G~~gfkg~kk~t~~Aa~~~a~~~~~~~~~~gi~~v~v~   85 (129)
                      +++++.++.++.|++||++|+|||||||||++||++ +|+|+|++||||++|+|+|||+++++.++++++++||+.|+|+
T Consensus         2 ~~~~k~~~~~~~~~ihI~~s~NNT~itlTd~~g~~~~~~~S~G~~gfkg~rk~t~~Aa~~aa~~~~~~~~~~gi~~v~v~   81 (136)
T 1s1h_K            2 NVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCREVGITAVHVK   81 (136)
T ss_dssp             ------CCCCCEEEEEEECCSSCCEEEEEETTSCEEEEEETTTSSCCHHHHHHCHHHHHHHHHHHHHHHHHTTCCEEEEE
T ss_pred             CEEEECCCCEEEEEEEEEECCCCEEEEEECCCCCEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             53375259889999999913798799998699997899981011134676553256889999999999998297089999


Q ss_pred             EECC--------CCCHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCC
Q ss_conf             9779--------986788877876369369999963889888868888678
Q gi|254780238|r   86 VSGL--------GAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR  128 (129)
Q Consensus        86 ikG~--------G~GR~~~ik~l~~~glkI~~I~D~T~ip~nGcRp~K~RR  128 (129)
                      ++|+        |+||+++|++|...+++|++|+|+||+|||||||||+||
T Consensus        82 ikG~g~~~~~~pG~Gr~~aikal~~~~l~I~~I~D~T~iphnGcR~~K~RR  132 (136)
T 1s1h_K           82 IRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRR  132 (136)
T ss_dssp             EESCCCCSSSSCCCSHHHHHHHHHHHSSEEEEEEECCCCCSSCSCCCTTCC
T ss_pred             EEECCCCCCCCCCCCHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCC
T ss_conf             970356544577860889999998789889999987999989979998877


No 5  
>>2zkq_k 40S ribosomal protein S14E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} (k:)
Probab=100.00  E-value=8.9e-43  Score=282.25  Aligned_cols=120  Identities=31%  Similarity=0.465  Sum_probs=114.7

Q ss_pred             CCCEEEECCCEEEEEEECCCCEEEEEECCCCCEEEEECCCCCCCCCCCC-CCCCHHHHHHHHHHHHHHHCCCCEEEEEEE
Q ss_conf             3430012252189999179877999970899889974044435577543-352037899999999999869819999997
Q gi|254780238|r    9 RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRK-NSPFAAQVATDDCSAKAQNHGMSSLEVKVS   87 (129)
Q Consensus         9 ~~k~~~~i~~GiihI~~t~NNTiitlTd~~Gn~i~~~S~G~~gfkg~kk-~t~~Aa~~~a~~~~~~~~~~gi~~v~v~ik   87 (129)
                      .++.++.++.|++||++|+|||||||||++||+++|+|+|++||++.+| +|+|||+++++.++++++++||+.|+|+++
T Consensus        19 ~~~~~~~~~~~ivhI~~t~NNT~itlTd~~g~~~~~~S~G~~gfk~~~k~~t~~Aa~~aa~~~~~~~~~~Gik~v~v~ik   98 (151)
T 2zkq_k           19 PQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLR   98 (151)
T ss_dssp             ----CCCCSBCCEEEEECSSCEEEEEECTTCCEEEEEESTTSSCCTTTTTTSHHHHHHHHHHHHHHTTTTCCCBCCEEEE
T ss_pred             CCCCCCCEEEEEEEEEEECCCCEEEEECCCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEEEEEE
T ss_conf             63035860789999996148827999869999899996576554547656653478999999999999819709999998


Q ss_pred             C--------CCCCHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCC
Q ss_conf             7--------9986788877876369369999963889888868888678
Q gi|254780238|r   88 G--------LGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR  128 (129)
Q Consensus        88 G--------~G~GR~~~ik~l~~~glkI~~I~D~T~ip~nGcRp~K~RR  128 (129)
                      |        ||+||+++|++|+..|++|.+|+|+||+|||||||||+||
T Consensus        99 G~~~~~~~~~G~Gr~~~ik~L~~~~lkI~~I~D~TpiphnGcRp~K~RR  147 (151)
T 2zkq_k           99 ATGGNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRR  147 (151)
T ss_dssp             SSCCBTTBCCCTTHHHHHHHHHHHTCCCSCEECCCCCCCSCSCCSCTTC
T ss_pred             EECCCCCCCCCCCHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCC
T ss_conf             5247666678875588899998789789999987999989989998877


No 6  
>>1vq8_N 50S ribosomal protein L18P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} (N:)
Probab=97.22  E-value=0.0031  Score=40.24  Aligned_cols=98  Identities=15%  Similarity=0.126  Sum_probs=76.3

Q ss_pred             CEEEEEEECCCCEEEEEE--CCCC-CEEEEECCCCCCCCCCCC--CCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCC--
Q ss_conf             218999917987799997--0899-889974044435577543--352037899999999999869819999997799--
Q gi|254780238|r   18 SGRAHVVSTFNNTRITIT--DPHG-NTIAWSSPKVVGFSGSRK--NSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLG--   90 (129)
Q Consensus        18 ~GiihI~~t~NNTiitlT--d~~G-n~i~~~S~G~~gfkg~kk--~t~~Aa~~~a~~~~~~~~~~gi~~v~v~ikG~G--   90 (129)
                      ...+-|..|.+++++.+.  |..| .+++.+|+-.+..++...  ...-||+.++..+++++.+.|+..+..-+-++.  
T Consensus        32 k~RLvVr~TNr~i~aQIv~~d~~gd~vlasAsS~El~~~g~~~~~~N~~AAy~vG~llA~Ral~~gi~~~vlD~G~~~~~  111 (187)
T 1vq8_N           32 KPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPT  111 (187)
T ss_dssp             SCEEEEEECSSCEEEEEEECCTTSCEEEEEEESGGGGGGTCCSCSSSHHHHHHHHHHHHHHHHHTTCCBCEEECTTSCCC
T ss_pred             CCEEEEEEECCCEEEEEEEECCCCCEEEEEEEHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             97699999478079999983389997999987113555222158627789999999999999850356058731777787


Q ss_pred             C-CH-HHHHHHHHHCCCEEEEEEECCCCCCCCCCCC
Q ss_conf             8-67-8887787636936999996388988886888
Q gi|254780238|r   91 A-GR-DSALRALRAIGFTIVSICDVTMIAHNGCRPR  124 (129)
Q Consensus        91 ~-GR-~~~ik~l~~~glkI~~I~D~T~ip~nGcRp~  124 (129)
                      . || .++++++...||+         +||+-.+-|
T Consensus       112 ~ggrV~A~~kga~d~Gl~---------iph~~~~~p  138 (187)
T 1vq8_N          112 PGSKVFAIQEGAIDAGLD---------IPHNDDVLA  138 (187)
T ss_dssp             TTCHHHHHHHHHHHTTCB---------CCCCGGGSC
T ss_pred             CCCHHHHHHHHHHHCCCC---------CCCCCCCCC
T ss_conf             674099899999966926---------788876588


No 7  
>>1ovy_A 50S ribosomal protein L18; ribosome; NMR {Geobacillus stearothermophilus} (A:)
Probab=97.16  E-value=0.00051  Score=45.05  Aligned_cols=92  Identities=21%  Similarity=0.178  Sum_probs=74.9

Q ss_pred             CCCEEEEEEECCCCEEEEEECCC-CCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCC-CH
Q ss_conf             25218999917987799997089-98899740444355775433520378999999999998698199999977998-67
Q gi|254780238|r   16 IVSGRAHVVSTFNNTRITITDPH-GNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGA-GR   93 (129)
Q Consensus        16 i~~GiihI~~t~NNTiitlTd~~-Gn~i~~~S~G~~gfkg~kk~t~~Aa~~~a~~~~~~~~~~gi~~v~v~ikG~G~-GR   93 (129)
                      .....+-|..|..++...+.|.. |.+++.+|+=.-.++.......-||+.+++.+++++.+.|+..+..-..|+=+ ||
T Consensus        26 ~~~pRL~V~~Snk~i~aqvvd~~~~~~lasaSt~ek~~~~~~~~n~~aa~~iG~~la~r~~~~gi~~v~~Drg~~~~~gr  105 (120)
T 1ovy_A           26 TERPRLSVFRSNKHIYAQIIDDTKSATIVSASTLDKEFGLDSTNNIEAAKKVGELVAKRALEKGIKQVVFDRGGYLYHGR  105 (120)
T ss_dssp             SSCCSEEEEEETTEEEEEEECCSSCCCEEEESTTSTTTCSSCTTSHHHHHHHHHHHHHHHHHHSSSCCCCCSTTCSSCSS
T ss_pred             CCCCEEEEEEECCEEEEEEEECCCCCEEEEECCCCHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHH
T ss_conf             89876999982782699999478894899824523443334688599999999999999998699889980799973179


Q ss_pred             -HHHHHHHHHCCCEE
Q ss_conf             -88877876369369
Q gi|254780238|r   94 -DSALRALRAIGFTI  107 (129)
Q Consensus        94 -~~~ik~l~~~glkI  107 (129)
                       .+++.++...||++
T Consensus       106 v~a~~~~~re~Gl~~  120 (120)
T 1ovy_A          106 VKALADAAREAGLEF  120 (120)
T ss_dssp             THHHHHHHHHHHCCC
T ss_pred             HHHHHHHHHHCCCCC
T ss_conf             999999999808889


No 8  
>>3i1n_O 50S ribosomal protein L18; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1p85_M 1p86_M 1vs8_O 2aw4_O 2awb_O 1vs6_O 2i2v_O 2j28_O 2i2t_O* 2qao_O* 2qba_O* 2qbc_O* 2qbe_O 2qbg_O 2qbi_O* 2qbk_O* 2qov_O 2qox_O 2qoz_O* 2qp1_O* ... (O:)
Probab=97.01  E-value=0.0053  Score=38.87  Aligned_cols=90  Identities=19%  Similarity=0.215  Sum_probs=72.5

Q ss_pred             CCEEEEEEECCCCEEEEEECCC-CCEEEEECCCCCCCCCCCC--CCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCC-C
Q ss_conf             5218999917987799997089-9889974044435577543--3520378999999999998698199999977998-6
Q gi|254780238|r   17 VSGRAHVVSTFNNTRITITDPH-GNTIAWSSPKVVGFSGSRK--NSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGA-G   92 (129)
Q Consensus        17 ~~GiihI~~t~NNTiitlTd~~-Gn~i~~~S~G~~gfkg~kk--~t~~Aa~~~a~~~~~~~~~~gi~~v~v~ikG~G~-G   92 (129)
                      ....+.|+.|.+++.+.+.|.. |.+++.+|+=...+++...  ....||+.+++.+++.+.+.|+..+..-..|+=+ |
T Consensus        22 ~~pRl~V~~Snk~i~aqiid~~~~~~l~sast~e~~~~~~~~~~~n~~Aa~~vG~~la~r~~~~gi~~v~~Drg~~~y~g  101 (117)
T 3i1n_O           22 GATRLVVHRTPRHIYAQVIAPNGSEVLVAASTVEKAIAEQLKYTGNKDAAAAVGKAVAERALEKGIKDVSFDRSGFQYHG  101 (117)
T ss_dssp             CCCEEEEEECSSCEEEEEECTTSSCEEEEEESSSSHHHHTCSSSSSTHHHHHHHHHHHHHHHHTTCCCCEEECTTSCTTS
T ss_pred             CCCEEEEEECCCCEEEEEEECCCCCEEEEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHH
T ss_conf             99759999718827999997798833664201467666432778776899999999999999879998997699975357


Q ss_pred             H-HHHHHHHHHCCCE
Q ss_conf             7-8887787636936
Q gi|254780238|r   93 R-DSALRALRAIGFT  106 (129)
Q Consensus        93 R-~~~ik~l~~~glk  106 (129)
                      | .+++.++...||+
T Consensus       102 rv~a~~~~~r~~Gl~  116 (117)
T 3i1n_O          102 RVQALADAAREAGLQ  116 (117)
T ss_dssp             TTHHHHHHHHTTTCC
T ss_pred             HHHHHHHHHHHCCCC
T ss_conf             999999999982888


No 9  
>>3bbo_Q Ribosomal protein L18; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Vitis vinifera} (Q:)
Probab=96.55  E-value=0.0016  Score=42.11  Aligned_cols=89  Identities=17%  Similarity=0.187  Sum_probs=69.4

Q ss_pred             CEEEEEEECCCCEEEEEEC-CCCCEEEEECCCCCCCCCC----CCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCC-
Q ss_conf             2189999179877999970-8998899740444355775----433520378999999999998698199999977998-
Q gi|254780238|r   18 SGRAHVVSTFNNTRITITD-PHGNTIAWSSPKVVGFSGS----RKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGA-   91 (129)
Q Consensus        18 ~GiihI~~t~NNTiitlTd-~~Gn~i~~~S~G~~gfkg~----kk~t~~Aa~~~a~~~~~~~~~~gi~~v~v~ikG~G~-   91 (129)
                      ...+.|+.|.++++..+.| ..|.++..+|+=.-.+++.    ......||+.+++.+++++++.||..+..-..|+=+ 
T Consensus        65 r~RL~V~~Snkhi~Aqii~~~~~~~l~~aST~~k~lk~~~~~~~~~n~~AA~~vG~~la~ra~~~gi~~vvfDrg~~~y~  144 (161)
T 3bbo_Q           65 RPRLCVFRSNKHLYVQVIDDSKMHTLASASTMQKSISEELDYSSSPTIEVAKKVGEVIASACLEKGITKVAFDRGGYPYH  144 (161)
T ss_dssp             CCCCEEEECSSCEEEEEECCTTSCEEEEEEHHHHHHHHCCTTCCSSSHHHHHHHHHHSSSHHHHTSSCCCCCCCSSSCSS
T ss_pred             CCEEEEEEECCEEEEEEEECCCCCEEEEEECCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCC
T ss_conf             87799997267179999956888589998533201322210032138999999999999999987998899807997320


Q ss_pred             CH-HHHHHHHHHCCCE
Q ss_conf             67-8887787636936
Q gi|254780238|r   92 GR-DSALRALRAIGFT  106 (129)
Q Consensus        92 GR-~~~ik~l~~~glk  106 (129)
                      || .+++.++...||+
T Consensus       145 grv~a~~~~~re~Gl~  160 (161)
T 3bbo_Q          145 GRVKALADAAREKGLQ  160 (161)
T ss_dssp             STTHHHHHHHTTTTCC
T ss_pred             CHHHHHHHHHHHCCCC
T ss_conf             1999999999984888


No 10 
>>2j01_S 50S ribosomal protein L18; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} (S:)
Probab=96.40  E-value=0.0014  Score=42.34  Aligned_cols=87  Identities=17%  Similarity=0.164  Sum_probs=65.0

Q ss_pred             CCEEEEEEECCCCEEEEEECCCC-CEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCC-CH-
Q ss_conf             52189999179877999970899-8899740444355775433520378999999999998698199999977998-67-
Q gi|254780238|r   17 VSGRAHVVSTFNNTRITITDPHG-NTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGA-GR-   93 (129)
Q Consensus        17 ~~GiihI~~t~NNTiitlTd~~G-n~i~~~S~G~~gfkg~kk~t~~Aa~~~a~~~~~~~~~~gi~~v~v~ikG~G~-GR-   93 (129)
                      ....+.|+.|..++.+.+.|..+ .+++.+|+=...+++.   ...||+.+++.+++.+++.|+..+..-..|+=+ || 
T Consensus        22 ~~~RL~V~~Snk~i~aqvid~~~~~~lasasT~e~~~~~~---n~~Aa~~vG~~la~r~~~~gi~~v~fDrg~~~y~grv   98 (112)
T 2j01_S           22 GRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKGN---KTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRV   98 (112)
T ss_dssp             SSCEEECCBCSSCBCEEEEETTTTEEEEEECSTTTCCCSC---HHHHHHHHHHHHHHHHHHTSCCCCBCCCSTTCSSSSC
T ss_pred             CCCEEEEEEECCEEEEEEEECCCCCEEEEECCCCCCCCCC---CHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHH
T ss_conf             9866999970781799999879883899861333222465---1999999999999999986998899808997212099


Q ss_pred             HHHHHHHHHCCCE
Q ss_conf             8887787636936
Q gi|254780238|r   94 DSALRALRAIGFT  106 (129)
Q Consensus        94 ~~~ik~l~~~glk  106 (129)
                      .++..++...||+
T Consensus        99 ~a~~~~~r~~Gl~  111 (112)
T 2j01_S           99 KALAEGAREGGLE  111 (112)
T ss_dssp             CCCSSCTTCC---
T ss_pred             HHHHHHHHHCCCC
T ss_conf             9999999984888


No 11 
>>2zjr_L 50S ribosomal protein L18; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} (L:23-114)
Probab=96.18  E-value=0.0048  Score=39.14  Aligned_cols=84  Identities=20%  Similarity=0.174  Sum_probs=65.1

Q ss_pred             EEEEEEECCCCEEEEEECCCCC-EEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCC-CH-HH
Q ss_conf             1899991798779999708998-899740444355775433520378999999999998698199999977998-67-88
Q gi|254780238|r   19 GRAHVVSTFNNTRITITDPHGN-TIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGA-GR-DS   95 (129)
Q Consensus        19 GiihI~~t~NNTiitlTd~~Gn-~i~~~S~G~~gfkg~kk~t~~Aa~~~a~~~~~~~~~~gi~~v~v~ikG~G~-GR-~~   95 (129)
                      ..+.|+.|.+++...+.|..++ ++..+|+-..+.+    +.-.||+.+++.+++++.+.||..+..-..|+=+ || .+
T Consensus         5 pRL~V~~Sn~~i~AQiidd~~~~tl~sasT~e~~~~----~~~~aa~~vG~~la~r~~~~gi~~vvfDrg~~~yhgrv~a   80 (92)
T 2zjr_L            5 LRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSG----NKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKA   80 (92)
T ss_dssp             EEECCCTTSSCCCCCEEETTTTEECCCCCSCSCCTT----CSSSSHHHHHHHHHHHHHTTCCCCCEECCCSSCSCSHHHH
T ss_pred             CEEEEEECCCCEEEEEEECCCCEEHHHHHHHHHCCC----CCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHH
T ss_conf             579999707706788883445220345442220024----4234789999887668998598089986899730119999


Q ss_pred             HHHHHHHCCCE
Q ss_conf             87787636936
Q gi|254780238|r   96 ALRALRAIGFT  106 (129)
Q Consensus        96 ~ik~l~~~glk  106 (129)
                      +..++...|++
T Consensus        81 ~~~~~re~Gl~   91 (92)
T 2zjr_L           81 LADAAREGGLD   91 (92)
T ss_dssp             HHHHHHHHC--
T ss_pred             HHHHHHHCCCC
T ss_conf             99999984898


No 12 
>>3jyw_E 60S ribosomal protein L5; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_E (E:)
Probab=94.14  E-value=0.021  Score=35.16  Aligned_cols=101  Identities=16%  Similarity=0.002  Sum_probs=74.7

Q ss_pred             CCCEEEEEEECCCCEEEEEECC--CC-CEEEEECCCCCCCCCCCC--CCCCHHHHHHHHHHHHHHHCCCCEEE-------
Q ss_conf             2521899991798779999708--99-889974044435577543--35203789999999999986981999-------
Q gi|254780238|r   16 IVSGRAHVVSTFNNTRITITDP--HG-NTIAWSSPKVVGFSGSRK--NSPFAAQVATDDCSAKAQNHGMSSLE-------   83 (129)
Q Consensus        16 i~~GiihI~~t~NNTiitlTd~--~G-n~i~~~S~G~~gfkg~kk--~t~~Aa~~~a~~~~~~~~~~gi~~v~-------   83 (129)
                      -++..+-|..|.+++++.+.|.  +| .+++.+|+-.+...+...  ....||+.++..+++++++.|+..+.       
T Consensus        36 s~kpRLvVrkSNkhI~aQIi~~~~~Gd~vlasAsS~El~~~g~~~~~~N~~AAy~vG~llAkRal~kgi~~v~Fdr~~~y  115 (237)
T 3jyw_E           36 TPKYRLVVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQRLGLDETYKGVEEV  115 (237)
T ss_dssp             SSSSSEECCCCSSCCEEECCCBCSSSBCCSSEEEGGGSTTTSCCSCSCBSHHHHHHHHHHHHCBSCSSSCSSBCSSCSSS
T ss_pred             CCCCEEEEEEECCCEEEEEEEECCCCCEEEEEEEHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHCCCCCC
T ss_conf             98735999997894899999732789999998517778664866787730799998899999998761717664576134


Q ss_pred             ----------------------EEEEC--CCCCHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCC
Q ss_conf             ----------------------99977--9986788877876369369999963889888868888
Q gi|254780238|r   84 ----------------------VKVSG--LGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK  125 (129)
Q Consensus        84 ----------------------v~ikG--~G~GR~~~ik~l~~~glkI~~I~D~T~ip~nGcRp~K  125 (129)
                                            |=+.-  .|.---+++++....||.         |||+-.|-|-
T Consensus       116 hGrv~a~ae~~re~G~~fa~lD~Gl~r~t~g~rvfaalkGa~DgGl~---------iPh~~~~fp~  172 (237)
T 3jyw_E          116 EGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLY---------VPHSENRFPG  172 (237)
T ss_dssp             SSCCCCCSCCCSSCCCCSCCEECCSSCCCTTCHHHHHHHHHHTTSSC---------CCCCSSSCCC
T ss_pred             CCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHCCCCCCC---------CCCCCCCCCC
T ss_conf             67610323345788872699734544577650178875410147844---------5788764888


No 13 
>>2zkr_n 60S ribosomal protein L5; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} (n:)
Probab=76.37  E-value=6  Score=20.18  Aligned_cols=101  Identities=21%  Similarity=0.130  Sum_probs=69.6

Q ss_pred             ECCCEEEEEEECCCCEEEEEEC--CCCCE-EEEECC---CCCCCCCCCCCCCCHHHHHHHHHHHHHHHC-CC--------
Q ss_conf             2252189999179877999970--89988-997404---443557754335203789999999999986-98--------
Q gi|254780238|r   15 NIVSGRAHVVSTFNNTRITITD--PHGNT-IAWSSP---KVVGFSGSRKNSPFAAQVATDDCSAKAQNH-GM--------   79 (129)
Q Consensus        15 ~i~~GiihI~~t~NNTiitlTd--~~Gn~-i~~~S~---G~~gfkg~kk~t~~Aa~~~a~~~~~~~~~~-gi--------   79 (129)
                      .-++..+-|..|..|+|+.+..  +.|+. ++.+.+   ...|+++...+.+ ||+.++-.++.+++.. |+        
T Consensus        45 ~s~K~RlVVR~TN~~ii~Qiv~~~~~GD~v~~sA~S~eL~kyG~k~g~~N~~-AAY~TGlL~arR~L~kl~ld~~y~g~~  123 (297)
T 2zkr_n           45 NTPKYRMIVRVTNRDIICQIAYARIEGDMIVCARYAHELPKYGVKVGLTNYA-AAYCTGLLLARRLLNRFGMDKIYEGQV  123 (297)
T ss_dssp             SCCSEEEEEEEETTEEEEEEEECCSSSCEEEEEEEGGGGGGTCCCSCSSSHH-HHHHHHHHHHHHHHCCCSCCCCCSSCC
T ss_pred             CCCCCEEEEEEECCCEEEEEEEECCCCCEEEEEEEHHHHHHCCCCCCCCCHH-HHHHHHHHHHHHHHHHCCCHHHHCCCC
T ss_conf             7986059999847938999998517898999986321386659888887328-999989999999987506202204640


Q ss_pred             ----------------CEEEEEEE-C-----CCCCHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCC
Q ss_conf             ----------------19999997-7-----9986788877876369369999963889888868888
Q gi|254780238|r   80 ----------------SSLEVKVS-G-----LGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK  125 (129)
Q Consensus        80 ----------------~~v~v~ik-G-----~G~GR~~~ik~l~~~glkI~~I~D~T~ip~nGcRp~K  125 (129)
                                      .....++. |     .|.---+++++....||.         |||+-.|-|-
T Consensus       124 e~~ge~~~ve~~~~~~~~~~aiLDiGL~rtt~G~RVFaalKGa~DgGl~---------IPHs~~rfpg  182 (297)
T 2zkr_n          124 EVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLS---------IPHSTKRFPG  182 (297)
T ss_dssp             SSSSCCCCCSSSCSSSCCCBEEEECTTSCCCTTCHHHHHHHHHHHTTCB---------CCCCGGGSCC
T ss_pred             CCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCEEEEEEECCCCCCCC---------CCCCCCCCCC
T ss_conf             2456402334334688861699723654576675345441002257866---------7898765788


No 14 
>>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} (O:1-148,O:314-330)
Probab=72.85  E-value=4.2  Score=21.11  Aligned_cols=36  Identities=31%  Similarity=0.506  Sum_probs=27.7

Q ss_pred             EEEEEEECCCC-CHHHHHHH-HHHCCCEEEEEEECCCCC
Q ss_conf             99999977998-67888778-763693699999638898
Q gi|254780238|r   81 SLEVKVSGLGA-GRDSALRA-LRAIGFTIVSICDVTMIA  117 (129)
Q Consensus        81 ~v~v~ikG~G~-GR~~~ik~-l~~~glkI~~I~D~T~ip  117 (129)
                      .+.|-|.|||. ||. ++|+ +....+.|+.|-|.+++.
T Consensus         1 tikI~INGFGRIGR~-v~R~~~~~~~~eiVaINd~~~~~   38 (165)
T 1gad_O            1 TIKVGINGFGRIGRI-VFRAAQKRSDIEIVAINDLLDAD   38 (165)
T ss_dssp             CEEEEEECCSHHHHH-HHHHHHTCSSEEEEEEECSSCHH
T ss_pred             CEEEEEECCCHHHHH-HHHHHHHCCCCEEEEECCCCCHH
T ss_conf             959999788789999-99998257990899981799989


No 15 
>>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O (O:1-153,O:318-337)
Probab=68.86  E-value=5.1  Score=20.59  Aligned_cols=37  Identities=27%  Similarity=0.457  Sum_probs=28.0

Q ss_pred             CCEEEEEEECCCC-CHHHHHHHHHHCCCEEEEEEEC-CC
Q ss_conf             8199999977998-6788877876369369999963-88
Q gi|254780238|r   79 MSSLEVKVSGLGA-GRDSALRALRAIGFTIVSICDV-TM  115 (129)
Q Consensus        79 i~~v~v~ikG~G~-GR~~~ik~l~~~glkI~~I~D~-T~  115 (129)
                      |..+.|-|.|||. ||..+--++....++|+.|-|. ++
T Consensus         1 M~~ikVgINGFGRIGR~v~R~~~~~~~i~iVaINd~~~~   39 (173)
T 3e5r_O            1 MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFIT   39 (173)
T ss_dssp             -CCEEEEEECCSHHHHHHHHHHHTCSSEEEEEEECSSSC
T ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             996299998985899999999964899789997589999


No 16 
>>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} (A:1-32,A:181-415)
Probab=67.61  E-value=5.3  Score=20.48  Aligned_cols=66  Identities=17%  Similarity=0.147  Sum_probs=42.5

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHH-HHCCCEEEEEEECCCCCCC
Q ss_conf             775433520378999999999998698199999977998678887787-6369369999963889888
Q gi|254780238|r   53 SGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRAL-RAIGFTIVSICDVTMIAHN  119 (129)
Q Consensus        53 kg~kk~t~~Aa~~~a~~~~~~~~~~gi~~v~v~ikG~G~GR~~~ik~l-~~~glkI~~I~D~T~ip~n  119 (129)
                      .|+...|.|-.....+.+.+. ....++...|.+.|||.=-..+.+-| +..|.+|+.|.|...--+|
T Consensus        34 ~gR~~ATg~GV~~~~~~al~~-~g~~l~g~rvaIqGfG~VG~~~A~~L~~e~GakiV~v~D~~G~i~~  100 (267)
T 2tmg_A           34 KGREEATGRGVKVCAGLAMDV-LGIDPKKATVAVQGFGNVGQFAALLISQELGSKVVAVSDSRGGIYN  100 (267)
T ss_dssp             TTTTTHHHHHHHHHHHHHHHH-TTCCTTTCEEEEECCSHHHHHHHHHHHHTTCCEEEEEECSSCEEEC
T ss_pred             CCCHHHHHHHHHHHHHHHHHH-CCCCCCCCEEEEEEECCCHHHHHHHHHHHCCCEEEEEECCCCEEEC
T ss_conf             620667887889999988874-7998578759999806816999987677579749997167734788


No 17 
>>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} (A:1-172,A:340-356)
Probab=62.28  E-value=7.8  Score=19.47  Aligned_cols=41  Identities=24%  Similarity=0.379  Sum_probs=34.0

Q ss_pred             HCCCCEEEEEEECCCCCHHHHHHHHHHCCCEEEEEEECCCC
Q ss_conf             86981999999779986788877876369369999963889
Q gi|254780238|r   76 NHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMI  116 (129)
Q Consensus        76 ~~gi~~v~v~ikG~G~GR~~~ik~l~~~glkI~~I~D~T~i  116 (129)
                      ......+.|-|.|||.=-..++|++...++.|+.|-|.+++
T Consensus        16 ~~~~~~ikVgINGFGRIGR~vlR~~~~~~i~iVaINd~~~~   56 (189)
T 3hja_A           16 TQGPGSMKLAINGFGRIGRNVFKIAFERGIDIVAINDLTDP   56 (189)
T ss_dssp             ------CEEEEECCSHHHHHHHHHHHHTTCEEEEEECSSCH
T ss_pred             CCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCH
T ss_conf             35998479999788778999999998299989998079999


No 18 
>>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} (O:1-150,O:314-334)
Probab=61.66  E-value=10  Score=18.71  Aligned_cols=35  Identities=29%  Similarity=0.502  Sum_probs=27.3

Q ss_pred             EEEEEECCCC-CHHHHHHHHHHCCCEEEEEEECCCC
Q ss_conf             9999977998-6788877876369369999963889
Q gi|254780238|r   82 LEVKVSGLGA-GRDSALRALRAIGFTIVSICDVTMI  116 (129)
Q Consensus        82 v~v~ikG~G~-GR~~~ik~l~~~glkI~~I~D~T~i  116 (129)
                      +.|-|.|||. ||..+--.|...++.|..|-|..++
T Consensus         2 ikIgINGFGRIGR~v~Ra~~~~~~~~ivaINd~~~~   37 (171)
T 3cmc_O            2 VKVGINGFGRIGRNVFRAALKNPDIEVVAVNDLTDA   37 (171)
T ss_dssp             EEEEEESCSHHHHHHHHHHTTCTTEEEEEEECSSCH
T ss_pred             EEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCH
T ss_conf             099995887789999999975899689998079998


No 19 
>>2i5p_O GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; rossmann fold, APO form, dimer, oxidoreductase; HET: GLC; 2.30A {Kluyveromyces marxianus} (O:1-161,O:328-342)
Probab=60.76  E-value=9.3  Score=19.00  Aligned_cols=40  Identities=25%  Similarity=0.453  Sum_probs=29.9

Q ss_pred             CCCCEEEEEEECCCCCHHHHHHH-HHHCCCEEEEEEEC-CCC
Q ss_conf             69819999997799867888778-76369369999963-889
Q gi|254780238|r   77 HGMSSLEVKVSGLGAGRDSALRA-LRAIGFTIVSICDV-TMI  116 (129)
Q Consensus        77 ~gi~~v~v~ikG~G~GR~~~ik~-l~~~glkI~~I~D~-T~i  116 (129)
                      ..+..+.|-|.|||.=-..++|+ +....+.|+.|-|. +++
T Consensus        10 ~~~~~ikVgINGFGRIGR~vlR~~~~~~~i~ivaINd~~~~~   51 (176)
T 2i5p_O           10 HGIQMVSIAINGFGRIGRLVLRIALERKNIDVVAINDPFISV   51 (176)
T ss_dssp             ----CEEEEEECCSHHHHHHHHHHTTCTTEEEEEEECTTSCH
T ss_pred             CCCCEEEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCH
T ss_conf             654189999978878999999999648996899977899998


No 20 
>>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, protein structure initiative, GAPDH, oxidoreductase; HET: NAD AES; 2.25A {Plasmodium falciparum} (O:1-160,O:327-345)
Probab=60.01  E-value=9.3  Score=19.00  Aligned_cols=40  Identities=25%  Similarity=0.364  Sum_probs=30.5

Q ss_pred             HCCCCEEEEEEECCCC-CHHHHHHHHHHCCCEEEEEEEC-CC
Q ss_conf             8698199999977998-6788877876369369999963-88
Q gi|254780238|r   76 NHGMSSLEVKVSGLGA-GRDSALRALRAIGFTIVSICDV-TM  115 (129)
Q Consensus        76 ~~gi~~v~v~ikG~G~-GR~~~ik~l~~~glkI~~I~D~-T~  115 (129)
                      ...+..+.|-|.|||. ||..+--.+....+.|+.|-|. ++
T Consensus         6 ~~~~~~~kVgINGFGRIGR~vlR~~~~~~~~~vvaINd~~~~   47 (179)
T 2b4r_O            6 HHHMAATKLGINGFGRIGRLVFRAAFGRKDIEVVAINDPFMD   47 (179)
T ss_dssp             -----CEEEEEECCSHHHHHHHHHHHTCSSEEEEEEECTTCC
T ss_pred             CCCEEEEEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             255241289997887689999999953899489998899999


No 21 
>>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} (A:1-150,A:322-342)
Probab=56.15  E-value=12  Score=18.40  Aligned_cols=35  Identities=34%  Similarity=0.530  Sum_probs=26.4

Q ss_pred             EEEEEEECCCC-CHHHHHHH-HHHCCCEEEEEEECCCC
Q ss_conf             99999977998-67888778-76369369999963889
Q gi|254780238|r   81 SLEVKVSGLGA-GRDSALRA-LRAIGFTIVSICDVTMI  116 (129)
Q Consensus        81 ~v~v~ikG~G~-GR~~~ik~-l~~~glkI~~I~D~T~i  116 (129)
                      .+.|-|.|||. ||. ++|+ |....+.|+.|-|..++
T Consensus         2 ~vkigINGFGRIGR~-vlRa~~~~~~i~vVaINd~~~~   38 (171)
T 2ep7_A            2 AIKVGINGFGRIGRS-FFRASWGREEIEIVAINDLTDA   38 (171)
T ss_dssp             -CEEEEECCSHHHHH-HHHHHTTCTTCEEEEEECSSCH
T ss_pred             CEEEEEECCCHHHHH-HHHHHHCCCCEEEEEEECCCCH
T ss_conf             769999678679999-9999715898499998179998


No 22 
>>3kws_A Putative sugar isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 1.68A {Parabacteroides distasonis atcc 8503} (A:)
Probab=53.90  E-value=14  Score=17.87  Aligned_cols=47  Identities=17%  Similarity=0.244  Sum_probs=34.2

Q ss_pred             HHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHCCCEEEEEEEC
Q ss_conf             99999999986981999999779986788877876369369999963
Q gi|254780238|r   67 TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDV  113 (129)
Q Consensus        67 a~~~~~~~~~~gi~~v~v~ikG~G~GR~~~ik~l~~~glkI~~I~D~  113 (129)
                      .+.+.+.+.++|+..|++.......-.+.+...+...|+.|.++.--
T Consensus        40 l~~~~~~~~~~G~~~iEl~~~~~~~~~~~l~~~l~~~gl~v~~~~~~   86 (287)
T 3kws_A           40 LNEKLDFXEKLGVVGFEPGGGGLAGRVNEIKQALNGRNIKVSAICAG   86 (287)
T ss_dssp             HHHHHHHHHHTTCCEEECBSTTCGGGHHHHHHHHTTSSCEECEEECC
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHCCEEEEEECC
T ss_conf             99999999982999999789744545999999999839958999338


No 23 
>>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics, oxidoreductase; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* (A:1-167,A:334-354)
Probab=51.92  E-value=14  Score=17.87  Aligned_cols=36  Identities=31%  Similarity=0.417  Sum_probs=27.5

Q ss_pred             CCEEEEEEECCCC-CHHHHHHH-HHHCCCEEEEEEE-CCC
Q ss_conf             8199999977998-67888778-7636936999996-388
Q gi|254780238|r   79 MSSLEVKVSGLGA-GRDSALRA-LRAIGFTIVSICD-VTM  115 (129)
Q Consensus        79 i~~v~v~ikG~G~-GR~~~ik~-l~~~glkI~~I~D-~T~  115 (129)
                      +..+.|-|.|||. ||. ++|+ +....+.|+.|-| .+.
T Consensus        15 ~m~ikVgINGFGRIGR~-vlR~~~~~~~i~iVaINd~~~d   53 (188)
T 3cps_A           15 YFQGTLGINGFGRIGRL-VLRACMERNDITVVAINDPFMD   53 (188)
T ss_dssp             ---CEEEEECCSHHHHH-HHHHHHTCSSCEEEEEECTTSC
T ss_pred             EEEEEEEEECCCHHHHH-HHHHHHHCCCCEEEEECCCCCC
T ss_conf             11045999787689999-9999975899689997899999


No 24 
>>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} (A:1-143,A:310-343)
Probab=51.77  E-value=18  Score=17.24  Aligned_cols=35  Identities=14%  Similarity=0.300  Sum_probs=25.5

Q ss_pred             EEEEEEECCCC-CHHHHHHHH-HHCCCEEEEEEECCCC
Q ss_conf             99999977998-678887787-6369369999963889
Q gi|254780238|r   81 SLEVKVSGLGA-GRDSALRAL-RAIGFTIVSICDVTMI  116 (129)
Q Consensus        81 ~v~v~ikG~G~-GR~~~ik~l-~~~glkI~~I~D~T~i  116 (129)
                      .+.|-+.|||. ||. +++++ ....+.++.|-|..|.
T Consensus         2 ~IkVgINGfGrIGR~-v~ra~~~~~d~eiV~Ind~~~~   38 (177)
T 2yyy_A            2 PAKVLINGYGSIGKR-VADAVSMQDDMEVIGVTKTKPD   38 (177)
T ss_dssp             CEEEEEECCSHHHHH-HHHHHHHSSSEEEEEEEESSCS
T ss_pred             CEEEEEECCCHHHHH-HHHHHHCCCCCEEEEEECCCCC
T ss_conf             779999798788999-9999830899589999489964


No 25 
>>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} (O:1-148,O:312-331)
Probab=49.62  E-value=16  Score=17.51  Aligned_cols=35  Identities=26%  Similarity=0.398  Sum_probs=28.8

Q ss_pred             EEEEEECCCCCHHHHHHHHHHCCCEEEEEEECCCC
Q ss_conf             99999779986788877876369369999963889
Q gi|254780238|r   82 LEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMI  116 (129)
Q Consensus        82 v~v~ikG~G~GR~~~ik~l~~~glkI~~I~D~T~i  116 (129)
                      +.|-|.|||.=-..++|++...+++|..|-|.+++
T Consensus         1 ikigINGFGRIGR~v~Ra~~~~~i~iVaINd~~~~   35 (168)
T 2g82_O            1 MKVGINGFGRIGRQVFRILHSRGVEVALINDLTDN   35 (168)
T ss_dssp             CEEEEECCSHHHHHHHHHHHHHTCCEEEEECSSCH
T ss_pred             CEEEEECCCHHHHHHHHHHHCCCCEEEEEECCCCH
T ss_conf             98999788789999999984699989999279998


No 26 
>>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} (O:1-151,O:316-335)
Probab=42.71  E-value=24  Score=16.48  Aligned_cols=34  Identities=32%  Similarity=0.420  Sum_probs=22.7

Q ss_pred             CEEEEEEECCCC-CHHHHHHHHHHCCCEEEEEEEC
Q ss_conf             199999977998-6788877876369369999963
Q gi|254780238|r   80 SSLEVKVSGLGA-GRDSALRALRAIGFTIVSICDV  113 (129)
Q Consensus        80 ~~v~v~ikG~G~-GR~~~ik~l~~~glkI~~I~D~  113 (129)
                      ..+.|-|.|||. ||..+--.+....+.+..|.|.
T Consensus         2 ~~ikIgINGFGRIGR~vlR~~~~~~~~~vv~i~n~   36 (171)
T 1u8f_O            2 GKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDP   36 (171)
T ss_dssp             -CCEEEEECCSHHHHHHHHHHHHHCSSEEEEEECS
T ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             96099996887799999999964899589998899


No 27 
>>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.00A {Pyrococcus horikoshii OT3} (A:1-140,A:301-334)
Probab=41.65  E-value=26  Score=16.27  Aligned_cols=34  Identities=21%  Similarity=0.376  Sum_probs=23.2

Q ss_pred             EEEEEECCCC-CHHHHHHHH-HHCCCEEEEEEECCCC
Q ss_conf             9999977998-678887787-6369369999963889
Q gi|254780238|r   82 LEVKVSGLGA-GRDSALRAL-RAIGFTIVSICDVTMI  116 (129)
Q Consensus        82 v~v~ikG~G~-GR~~~ik~l-~~~glkI~~I~D~T~i  116 (129)
                      +.|-+-|+|. ||. +++++ ...+++|+-|.|.+|-
T Consensus         3 IkVgI~G~GrIGr~-~~ra~~~~~d~eiVaV~d~~p~   38 (174)
T 2czc_A            3 VKVGVNGYGTIGKR-VAYAVTKQDDMELIGITKTKPD   38 (174)
T ss_dssp             EEEEEECCSHHHHH-HHHHHHTCTTEEEEEEEESSCS
T ss_pred             EEEEEECCHHHHHH-HHHHHHHCCCCEEEEEECCCHH
T ss_conf             58999898088999-9999953899689999689869


No 28 
>>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus dsm 3638} (A:183-393)
Probab=38.81  E-value=29  Score=16.00  Aligned_cols=63  Identities=11%  Similarity=0.162  Sum_probs=43.4

Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHH-HCCCEEEEEEECCCCCCC
Q ss_conf             335203789999999999986981999999779986788877876-369369999963889888
Q gi|254780238|r   57 KNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALR-AIGFTIVSICDVTMIAHN  119 (129)
Q Consensus        57 k~t~~Aa~~~a~~~~~~~~~~gi~~v~v~ikG~G~GR~~~ik~l~-~~glkI~~I~D~T~ip~n  119 (129)
                      -.|.|....+.+.+.+..-...++.+.|.+-|+|.=-.++++.|. ..+.++..+.|....-++
T Consensus         6 ~~T~~gv~~~~~~al~~~~~~~~~~~~v~i~G~G~VG~~~~~~L~~~~~~~vv~~~d~~~~i~~   69 (211)
T 1gtm_A            6 EATARGASYTIREAAKVLGWDTLKGKTIAIQGYGNAGYYLAKIMSEDFGMKVVAVSDSKGGIYN   69 (211)
T ss_dssp             THHHHHHHHHHHHHHHHTTCSCSTTCEEEEECCSHHHHHHHHHHHHTTCCEEEEEECSSCEEEE
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCHHHHHHHHHHHHCCCEEEEEEECCCCEEEC
T ss_conf             3356999999999999828988679779970887468999999973397489997257852765


No 29 
>>3g9k_S Capsule biosynthesis protein CAPD; CAPD protein, the great lakes regional center of excellence, GLRCE, capsule biogenesis/degradation; HET: GLU; 1.79A {Bacillus anthracis} PDB: 3ga9_S* (S:1-107,S:144-177)
Probab=38.23  E-value=29  Score=15.94  Aligned_cols=24  Identities=21%  Similarity=0.267  Sum_probs=18.9

Q ss_pred             EEEEEECCCCCEEEEECCCCCCCC
Q ss_conf             799997089988997404443557
Q gi|254780238|r   30 TRITITDPHGNTIAWSSPKVVGFS   53 (129)
Q Consensus        30 TiitlTd~~Gn~i~~~S~G~~gfk   53 (129)
                      ||+++.|.+||.++..++-...|-
T Consensus         2 ThisVvD~dGNaVS~T~Si~~~FG   25 (141)
T 3g9k_S            2 THFVIIDRDGTVVSSTNTLSNFFG   25 (141)
T ss_dssp             EEEEEECTTCCEEEEEEECSSTTT
T ss_pred             EEEEEECCCCCEEEEECCCCCCCC
T ss_conf             599999189999999876899876


No 30 
>>3h9e_A Glyceraldehyde-3-phosphate dehydrogenase, testis- specific; oxidoreductase, structural genomics, structural genomics consortium, SGC, cytoplasm; HET: NAD; 1.72A {Homo sapiens} PDB: 2vyn_D* 2vyv_D* (A:1-155,A:321-346)
Probab=37.03  E-value=31  Score=15.83  Aligned_cols=36  Identities=28%  Similarity=0.351  Sum_probs=29.2

Q ss_pred             CEEEEEEECCCCCHHHHHHHHHHCCCEEEEEEEC-CC
Q ss_conf             1999999779986788877876369369999963-88
Q gi|254780238|r   80 SSLEVKVSGLGAGRDSALRALRAIGFTIVSICDV-TM  115 (129)
Q Consensus        80 ~~v~v~ikG~G~GR~~~ik~l~~~glkI~~I~D~-T~  115 (129)
                      ..+.|-|.|||.=-..++|++...++.|+.|.|. +.
T Consensus         6 ~~ikvgINGFGRIGR~vlRa~~~~~i~iVaINd~~~d   42 (181)
T 3h9e_A            6 RELTVGINGFGRIGRLVLRACMEKGVKVVAVNDPFID   42 (181)
T ss_dssp             CCCEEEEECCSHHHHHHHHHHHHTTCEEEEEECTTCC
T ss_pred             CEEEEEEECCCHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             5638999788779999999997099989998689999


No 31 
>>3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} PDB: 3l6r_A* 3hmk_A* 3l6c_A* (A:73-154)
Probab=33.68  E-value=35  Score=15.50  Aligned_cols=55  Identities=18%  Similarity=0.150  Sum_probs=38.9

Q ss_pred             CCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHCCCEEEEE
Q ss_conf             89988997404443557754335203789999999999986981999999779986788877876369369999
Q gi|254780238|r   37 PHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSI  110 (129)
Q Consensus        37 ~~Gn~i~~~S~G~~gfkg~kk~t~~Aa~~~a~~~~~~~~~~gi~~v~v~ikG~G~GR~~~ik~l~~~glkI~~I  110 (129)
                      ..++.+.+.|+|+.|                ..++..+..+|++.+.+.=....+.+...++.+   |-+|..+
T Consensus         2 ~~~~~vv~aSsGN~g----------------~a~A~~a~~~G~~~~iv~p~~~~~~k~~~l~~~---GA~Vi~~   56 (82)
T 3l6b_A            2 RKPKAVVTHSSGNHG----------------QALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAY---GASIVYC   56 (82)
T ss_dssp             CCCSCEEEECSSHHH----------------HHHHHHHHHTTCCEEEEEETTSCHHHHHHHHHT---TCEEEEE
T ss_pred             CCCCEEEEECCCCHH----------------HHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCC---CCCEEEC
T ss_conf             599889997998379----------------999999998599865568605678998887516---8743870


No 32 
>>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics, NPPSFA; HET: PLP; 1.15A {Thermus thermophilus HB8} (A:1-32,A:277-407)
Probab=32.72  E-value=36  Score=15.40  Aligned_cols=52  Identities=17%  Similarity=0.226  Sum_probs=39.3

Q ss_pred             CCHHHHH--HHHHHHHHHHCCCCE---------EEEEEECCCCCHHHHHHHHHHCCCEEEEEE
Q ss_conf             2037899--999999999869819---------999997799867888778763693699999
Q gi|254780238|r   60 PFAAQVA--TDDCSAKAQNHGMSS---------LEVKVSGLGAGRDSALRALRAIGFTIVSIC  111 (129)
Q Consensus        60 ~~Aa~~~--a~~~~~~~~~~gi~~---------v~v~ikG~G~GR~~~ik~l~~~glkI~~I~  111 (129)
                      .||.|.+  +..+++...+.|++-         |-|-++.+|-.-..+-+.|...||-+....
T Consensus        37 ~Ya~qVv~NAkaLA~~L~~~G~~VvsgGTdnHlvlvDl~~~gi~G~~ae~~Le~agI~vNkn~   99 (163)
T 2dkj_A           37 EYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNA   99 (163)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTCEEGGGSCSSSEEEEECGGGTCCHHHHHHHHHHTTEECEECC
T ss_pred             HHHHHHHHHHHCCCHHHHHCCCCCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHCCEEECCCC
T ss_conf             999999999982712786289741358887763652144567519999999998093873574


No 33 
>>2v36_B Gamma-glutamyltranspeptidase small chain; transferase, glutathione biosynthesis, gamma-glutamyl transferase, acyltransferase, zymogen; 1.85A {Bacillus subtilis} (B:)
Probab=31.95  E-value=37  Score=15.32  Aligned_cols=18  Identities=28%  Similarity=0.650  Sum_probs=15.2

Q ss_pred             EEEEEECCCCCEEEEECC
Q ss_conf             799997089988997404
Q gi|254780238|r   30 TRITITDPHGNTIAWSSP   47 (129)
Q Consensus        30 TiitlTd~~Gn~i~~~S~   47 (129)
                      |++++.|.+||.++..++
T Consensus         2 th~svvD~~GnaVs~T~S   19 (193)
T 2v36_B            2 THFTVADRWGNVVSYTTT   19 (193)
T ss_dssp             EEEEEEETTSCEEEEEEE
T ss_pred             EEEEEECCCCCEEEEECC
T ss_conf             599999389999999865


No 34 
>>1hwx_A GDH, glutamate dehydrogenase; allostery, abortive complex, oxidoreductase; HET: GLU GTP NAI; 2.50A {Bos taurus} (A:242-372)
Probab=31.07  E-value=38  Score=15.23  Aligned_cols=38  Identities=18%  Similarity=0.205  Sum_probs=29.9

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHCCCEEEEEEECCCCCC
Q ss_conf             99999977998678887787636936999996388988
Q gi|254780238|r   81 SLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAH  118 (129)
Q Consensus        81 ~v~v~ikG~G~GR~~~ik~l~~~glkI~~I~D~T~ip~  118 (129)
                      ...|.+-|+|.=-.++.+-|...|.+++-+.|....-+
T Consensus         3 g~rV~i~G~G~VG~~~a~~L~~~G~kvv~v~d~~G~i~   40 (131)
T 1hwx_A            3 DKTFAVQGFGNVGLHSMRYLHRFGAKCVAVGESDGSIW   40 (131)
T ss_dssp             TCEEEEECCSHHHHHHHHHHHHTTCEEEEEEETTEEEC
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCCEE
T ss_conf             86799979871558999777735747999974788354


No 35 
>>2jvf_A De novo protein M7; tetrapeptide fragment-based protein design, artificial fold; NMR {Unidentified} (A:)
Probab=30.13  E-value=40  Score=15.13  Aligned_cols=28  Identities=21%  Similarity=0.265  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEECC
Q ss_conf             3789999999999986981999999779
Q gi|254780238|r   62 AAQVATDDCSAKAQNHGMSSLEVKVSGL   89 (129)
Q Consensus        62 Aa~~~a~~~~~~~~~~gi~~v~v~ikG~   89 (129)
                      -|...++.++....++||+.+.|.+.|-
T Consensus        61 qA~~~~~li~r~~~~LGY~DINV~~~G~   88 (96)
T 2jvf_A           61 QAKELLELIARLLQKLGYKDINVRVNGT   88 (96)
T ss_dssp             HHHHHHHHHHHHHHHHTCSEEEEEEETT
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             8999999999999983976318998585


No 36 
>>1qys_A TOP7; alpha-beta, novel fold, de novo protein; 2.50A {Computationally designed sequence} (A:)
Probab=29.65  E-value=41  Score=15.08  Aligned_cols=28  Identities=14%  Similarity=0.073  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEECC
Q ss_conf             3789999999999986981999999779
Q gi|254780238|r   62 AAQVATDDCSAKAQNHGMSSLEVKVSGL   89 (129)
Q Consensus        62 Aa~~~a~~~~~~~~~~gi~~v~v~ikG~   89 (129)
                      -|...++.+++...++||+.+.|.+.|-
T Consensus        59 qA~~~~~li~r~~~~LGY~DINV~~~G~   86 (106)
T 1qys_A           59 EAEKFAAILIKVFAELGYNDINVTFDGD   86 (106)
T ss_dssp             HHHHHHHHHHHHHHHTTCCEEEEEEETT
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             8999999999999983976318998581


No 37 
>>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} (A:177-395)
Probab=28.35  E-value=43  Score=14.94  Aligned_cols=68  Identities=22%  Similarity=0.277  Sum_probs=50.1

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHCCCEEEEEEECCCCCC
Q ss_conf             355775433520378999999999998698199999977998678887787636936999996388988
Q gi|254780238|r   50 VGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAH  118 (129)
Q Consensus        50 ~gfkg~kk~t~~Aa~~~a~~~~~~~~~~gi~~v~v~ikG~G~GR~~~ik~l~~~glkI~~I~D~T~ip~  118 (129)
                      .||-+...+|.+........ +.+.....++...|.+-|+|.--..+.+-|...|-+++.+.|....-+
T Consensus         4 gg~~dd~~gTg~gv~~~~~~-~l~~~g~~l~~~rv~i~G~G~vg~~~a~~l~~~g~~~i~~~d~~G~i~   71 (219)
T 1v9l_A            4 WGNPVREYATGFGVAVATRE-MAKKLWGGIEGKTVAIQGMGNVGRWTAYWLEKMGAKVIAVSDINGVAY   71 (219)
T ss_dssp             SCCGGGGGHHHHHHHHHHHH-HHHHHHSCCTTCEEEEECCSHHHHHHHHHHHTTTCEEEEEECSSCEEE
T ss_pred             CCCCCCCEEEEEEEHHHHHH-HHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHCCCEEEEEECCCCCEE
T ss_conf             65699762899955344899-998632785677699984256315777766523233899972687422


No 38 
>>2hpi_A DNA polymerase III alpha subunit; POL-beta-like nucleotidyltransferase fold; HET: DNA; 3.00A {Thermus aquaticus} PDB: 2hpm_A* 3e0d_A* (A:294-450)
Probab=27.36  E-value=14  Score=17.93  Aligned_cols=47  Identities=30%  Similarity=0.399  Sum_probs=32.2

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHCCCEEEEEEECCCCCCC
Q ss_conf             3789999999999986981999999779986788877876369369999963889888
Q gi|254780238|r   62 AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN  119 (129)
Q Consensus        62 Aa~~~a~~~~~~~~~~gi~~v~v~ikG~G~GR~~~ik~l~~~glkI~~I~D~T~ip~n  119 (129)
                      ..+.+...+.+.|++.||-        .|+||.++--+|..-   ..-|+|+-|+.||
T Consensus       108 ~YFLiv~d~v~~ak~~gi~--------vGpgRGSaagSlVay---lLgIT~iDPl~~~  154 (157)
T 2hpi_A          108 GYFLIVQDYINWARGHGVS--------VGPGRGSAAGSLVAY---AVGITNIDPLRFG  154 (157)
T ss_dssp             HHHHHHHHHHHHHHTTTCC--------BCSCCGGGGGCHHHH---HTTSCCSCTTTTT
T ss_pred             CEEEECHHHHHHHHHCCEE--------ECCCCCCCCCCHHHH---HCCCCCCCCCCCC
T ss_conf             5133200566788648910--------145778777445556---4037786877788


No 39 
>>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} (A:26-53,A:320-483)
Probab=26.11  E-value=47  Score=14.70  Aligned_cols=62  Identities=21%  Similarity=0.229  Sum_probs=45.1

Q ss_pred             CHHHHH--HHHHHHHHHHCCCCE---------EEEEEECCCCCHHHHHHHHHHCCCEEEEEE---ECCCCCCCCCC
Q ss_conf             037899--999999999869819---------999997799867888778763693699999---63889888868
Q gi|254780238|r   61 FAAQVA--TDDCSAKAQNHGMSS---------LEVKVSGLGAGRDSALRALRAIGFTIVSIC---DVTMIAHNGCR  122 (129)
Q Consensus        61 ~Aa~~~--a~~~~~~~~~~gi~~---------v~v~ikG~G~GR~~~ik~l~~~glkI~~I~---D~T~ip~nGcR  122 (129)
                      ||.|.+  +..+++...+.|+.-         |-|-++..|..-..+-+.|...||.+....   |..|..-.|-|
T Consensus        35 Ya~qVv~NAk~LA~~L~~~G~~vvsGgTdnHlvlidl~~~gi~G~~ae~~Le~~gI~vNkn~iP~d~sp~~~sGiR  110 (192)
T 1rv3_A           35 YQRQVVANCRALSAALVELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDKSALRPSGLR  110 (192)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCEEGGGSCSSSEEEEEGGGGTCCHHHHHHHHHHTTEECEEECCSSCSCTTSCCEEE
T ss_pred             HHHHHHHHHHHHHHHHHHCCCEEECCCCCCCEEEEEEHHCCCCHHHHHHHHHHCCCEECCCCCCCCCCCCCCCEEE
T ss_conf             9999999999999999968967526988766378752211887999999999829577878578999999998048


No 40 
>>3l23_A Sugar phosphate isomerase/epimerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Parabacteroides distasonis} (A:)
Probab=25.18  E-value=49  Score=14.59  Aligned_cols=50  Identities=20%  Similarity=0.183  Sum_probs=38.2

Q ss_pred             HHHHHHHHHHHHCCCCEEEEEEECCC----CCHHHHHHHHHHCCCEEEEEEECC
Q ss_conf             99999999999869819999997799----867888778763693699999638
Q gi|254780238|r   65 VATDDCSAKAQNHGMSSLEVKVSGLG----AGRDSALRALRAIGFTIVSICDVT  114 (129)
Q Consensus        65 ~~a~~~~~~~~~~gi~~v~v~ikG~G----~GR~~~ik~l~~~glkI~~I~D~T  114 (129)
                      .-.+.+.+.+.++|+..|++...++.    .....+-+.+...|++|..+.-..
T Consensus        29 ~~~~e~l~~~~~~G~~~vEl~~~~~~~~~~~~~~~~~~~l~~~gl~i~~~~~~~   82 (303)
T 3l23_A           29 GDVAANLRKVKDXGYSKLELAGYGKGAIGGVPXXDFKKXAEDAGLKIISSHVNP   82 (303)
T ss_dssp             SCHHHHHHHHHHTTCCEEEECCEETTEETTEEHHHHHHHHHHTTCEEEEEECCC
T ss_pred             CCHHHHHHHHHHHCCCEEEECCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCC
T ss_conf             899999999998599989986777756689999999999997899488714575


No 41 
>>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A (A:1-58)
Probab=24.34  E-value=51  Score=14.49  Aligned_cols=19  Identities=42%  Similarity=0.691  Sum_probs=15.9

Q ss_pred             EEEEECCCCCEEEEECCCC
Q ss_conf             9999708998899740444
Q gi|254780238|r   31 RITITDPHGNTIAWSSPKV   49 (129)
Q Consensus        31 iitlTd~~Gn~i~~~S~G~   49 (129)
                      -++.+|++|+.-.|.++-.
T Consensus        35 k~tY~Dp~G~~RtWE~a~R   53 (58)
T 2dsc_A           35 KTTYMDPTGKTRTWESVKR   53 (58)
T ss_dssp             EEEEECTTSCEEEEEEEEE
T ss_pred             EEEEECCCCCEEEEEEEEE
T ss_conf             9999989989889999994


No 42 
>>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCSG, protein structure initiative, PSI; 2.61A {Thermotoga maritima MSB8} (A:168-323)
Probab=23.30  E-value=53  Score=14.37  Aligned_cols=55  Identities=20%  Similarity=0.203  Sum_probs=43.1

Q ss_pred             HHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHCCCEEEEEEECCCCCCCCC
Q ss_conf             9999999998698199999977998678887787636936999996388988886
Q gi|254780238|r   67 TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC  121 (129)
Q Consensus        67 a~~~~~~~~~~gi~~v~v~ikG~G~GR~~~ik~l~~~glkI~~I~D~T~ip~nGc  121 (129)
                      +-..+.+.....+....|.+-|+|.--..+.+.|...|-+++.+.|....-++|.
T Consensus        11 ~~~~a~~~~~~~l~~~~v~v~G~G~vG~~~a~~l~~~Ga~~i~v~d~~g~~~~~~   65 (156)
T 1vl6_A           11 AFLNALKLTEKKIEEVKVVVNGIGAAGYNIVKFLLDLGVKNVVAVDRKGILNEND   65 (156)
T ss_dssp             HHHHHHHHHTCCTTTCEEEEECCSHHHHHHHHHHHHHTCCEEEEEETTEECCTTS
T ss_pred             HHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEEEEEECCC
T ss_conf             9999998607874434899954637889999999984786159995011675588


No 43 
>>2hnh_A DNA polymerase III alpha subunit; DNA replication, nucleotidyltransferase, POL beta, PHP; HET: DNA; 2.30A {Escherichia coli} PDB: 2hqa_A* (A:278-389)
Probab=22.55  E-value=19  Score=17.16  Aligned_cols=47  Identities=19%  Similarity=0.311  Sum_probs=32.3

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHCCCEEEEEEECCCCCCC
Q ss_conf             3789999999999986981999999779986788877876369369999963889888
Q gi|254780238|r   62 AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN  119 (129)
Q Consensus        62 Aa~~~a~~~~~~~~~~gi~~v~v~ikG~G~GR~~~ik~l~~~glkI~~I~D~T~ip~n  119 (129)
                      ..+.+...+.+.|++.||-        .|+||-++--+|..-   ..-|+++-|+.||
T Consensus        62 ~YFLiv~d~v~~ak~~gi~--------vgpgRGSaagSlV~y---lLgIT~vdPi~~~  108 (112)
T 2hnh_A           62 GYFLIVMEFIQWSKDNGVP--------VGPGRGSGAGSLVAY---ALKITDLDPLEFD  108 (112)
T ss_dssp             HHHHHHHHHHHHHHHTTCC--------BCSCCTTGGGCHHHH---HTTSSCSCTTTTT
T ss_pred             HHHHHHHHHHHHHHHCCEE--------EECCCCCCCCEEEEE---EECCCCCCCCCCC
T ss_conf             9999999999998726578--------513677545601244---2046455852257


No 44 
>>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* 2vmr_A* 2vms_A* 2vmt_A* 2vmu_A* 2vmq_A* ... (A:1-32,A:276-405)
Probab=22.41  E-value=55  Score=14.26  Aligned_cols=51  Identities=22%  Similarity=0.294  Sum_probs=38.1

Q ss_pred             CHHHHH--HHHHHHHHHHCCCCE---------EEEEEECCCCCHHHHHHHHHHCCCEEEEEE
Q ss_conf             037899--999999999869819---------999997799867888778763693699999
Q gi|254780238|r   61 FAAQVA--TDDCSAKAQNHGMSS---------LEVKVSGLGAGRDSALRALRAIGFTIVSIC  111 (129)
Q Consensus        61 ~Aa~~~--a~~~~~~~~~~gi~~---------v~v~ikG~G~GR~~~ik~l~~~glkI~~I~  111 (129)
                      ||.|.+  |..+++...+.|+.-         |-|-++..|..-..+-+.|...|+.+..-.
T Consensus        38 Ya~qVv~NAk~La~~L~~~G~~vvsggTdnHlvlidl~~~gi~G~~ae~~Le~agI~vNkn~   99 (162)
T 2vi8_A           38 YAKRVVDNAKRLASALQNEGFTLVSGGTDNHLLLVDLRPQQLTGKTAEKVLDEVGITVNKNT   99 (162)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCEEGGGSCSSSEEEEECGGGTCCHHHHHHHHHHHTEECEEEC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCEECCCCCCCEEEEECCCCCCCHHHHHHHHHHHCEEECCCC
T ss_conf             99999998889999986479423348876645653102456618999999998294865575


No 45 
>>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- terminal domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} (A:1-112,A:246-302)
Probab=22.16  E-value=56  Score=14.23  Aligned_cols=42  Identities=19%  Similarity=0.060  Sum_probs=33.1

Q ss_pred             EEEEEECCCCCHHHHHHHHHHCCCEEEEEEECCCCCCCCCCC
Q ss_conf             999997799867888778763693699999638898888688
Q gi|254780238|r   82 LEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRP  123 (129)
Q Consensus        82 v~v~ikG~G~GR~~~ik~l~~~glkI~~I~D~T~ip~nGcRp  123 (129)
                      -.|++=|=|.+-.++.+.|.+.+.+|+.|......||+.|..
T Consensus        10 ~~vVIIGgG~AG~~~A~~Lr~~~~~Itvi~~e~~~~y~~~~l   51 (169)
T 3klj_A           10 TKILILGAGPAGFSAAKAALGKCDDITMINSEKYLPYYRPRL   51 (169)
T ss_dssp             CSEEEECCSHHHHHHHHHHTTTCSCEEEECSSSSCCBCGGGH
T ss_pred             CCEEEECCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCH
T ss_conf             999999998999999999827999789997998875656755


No 46 
>>3ju2_A Uncharacterized protein SMC04130; structural genomics, PSI-2, TIM barrel protein, protein structure initiative, Zn binding domain; 1.80A {Sinorhizobium meliloti} (A:)
Probab=21.71  E-value=39  Score=15.22  Aligned_cols=41  Identities=22%  Similarity=0.340  Sum_probs=13.5

Q ss_pred             HHHHHHHCCCCEEEEEEECCCC-CHHHHHHHHHHCCCEEEEE
Q ss_conf             9999998698199999977998-6788877876369369999
Q gi|254780238|r   70 CSAKAQNHGMSSLEVKVSGLGA-GRDSALRALRAIGFTIVSI  110 (129)
Q Consensus        70 ~~~~~~~~gi~~v~v~ikG~G~-GR~~~ik~l~~~glkI~~I  110 (129)
                      ..+.+.+.|+..|++....+.+ ..+.+.+.+...|+++.++
T Consensus        24 ~~~~~~~~G~~~iEl~~~~~~~~~~~~~~~~l~~~gi~~~~~   65 (284)
T 3ju2_A           24 AVDICLKHGITAIAPWRDQVAAIGLGEAGRIVRANGLKLTGL   65 (284)
T ss_dssp             HHHHHHHTTCCEEECBHHHHHHHCHHHHHHHHHHTTCEESCE
T ss_pred             HHHHHHHHCCCEEEECCCCCCCCCHHHHHHHHHHCCCEEEEE
T ss_conf             999999809999997576667579999999999709868883


No 47 
>>1now_A Beta-hexosaminidase beta chain; (beta/alpha)8-barrel, homodimer, family 20 glycosidase, hydrolase; HET: NAG IFG; 2.20A {Homo sapiens} (A:151-469)
Probab=21.65  E-value=57  Score=14.17  Aligned_cols=63  Identities=14%  Similarity=-0.001  Sum_probs=34.7

Q ss_pred             CCEEEEEECCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCC
Q ss_conf             8779999708998899740444355775433520378999999999998698199999977998
Q gi|254780238|r   28 NNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGA   91 (129)
Q Consensus        28 NNTiitlTd~~Gn~i~~~S~G~~gfkg~kk~t~~Aa~~~a~~~~~~~~~~gi~~v~v~ikG~G~   91 (129)
                      |--+++++|-.+-.+-..|-..+.-+++.+...+=.+.-...+.+.|+++|| .|.-.|..||-
T Consensus        33 N~lhlhl~D~~~~~~~~~~~p~l~~~~~~~~~~~yT~~ei~~l~~yA~~~gI-~iIPeid~pgH   95 (319)
T 1now_A           33 NVLHWHIVDDQSFPYQSITFPELSNKGSYSLSHVYTPNDVRMVIEYARLRGI-RVLPEFDTPGH   95 (319)
T ss_dssp             CEEEEECCCSSCCCBCCSSCHHHHHHHSSSTTSCBCHHHHHHHHHHHHHTTC-EEEEEEEESSS
T ss_pred             CEEEEEEECCHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC-EEEECCCCCCH
T ss_conf             7799996204210220445642133577677887699999999999997498-89864667326


No 48 
>>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} (A:1-140,A:297-339)
Probab=21.47  E-value=25  Score=16.37  Aligned_cols=34  Identities=15%  Similarity=0.133  Sum_probs=23.1

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHCCCEEEEEEECC
Q ss_conf             9999997799867888778763693699999638
Q gi|254780238|r   81 SLEVKVSGLGAGRDSALRALRAIGFTIVSICDVT  114 (129)
Q Consensus        81 ~v~v~ikG~G~GR~~~ik~l~~~glkI~~I~D~T  114 (129)
                      ..+|.+=|-||+-.++-..+.+.|+++..|...-
T Consensus         4 ~yDViVIGaGpAG~~AA~~aa~~G~kV~liE~~~   37 (183)
T 3l8k_A            4 KYDVVVIGAGGAGYHGAFRLAKAKYNVLMADPKG   37 (183)
T ss_dssp             EEEEEEECCSHHHHHHHHHHHHTTCCEEEECTTS
T ss_pred             CCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             6858998989899999999996899689996389


No 49 
>>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, catalytic loop; HET: 9DA; 1.85A {Giardia intestinalis} (A:)
Probab=21.14  E-value=59  Score=14.10  Aligned_cols=55  Identities=5%  Similarity=-0.063  Sum_probs=38.0

Q ss_pred             HHHHHHHHHHHHHHCCCCEEE---EEEECCCCCHHHHHHHHHHCCCEEEEEEECCCCCCC
Q ss_conf             789999999999986981999---999779986788877876369369999963889888
Q gi|254780238|r   63 AQVATDDCSAKAQNHGMSSLE---VKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN  119 (129)
Q Consensus        63 a~~~a~~~~~~~~~~gi~~v~---v~ikG~G~GR~~~ik~l~~~glkI~~I~D~T~ip~n  119 (129)
                      .-.+...+++.+++.|.+.+.   +..+|..  -......|...|+++.+|....++++|
T Consensus       129 TG~T~~~~~~~l~~~Ga~vv~v~v~~~~~~~--~~~~~~~l~~~~i~~~~l~~~~~~~~~  186 (186)
T 1l1q_A          129 TGGTLLAAIELCETAGVKPENIYINVLYEIE--ALKGREKVGQKCTRLFSVIREHHHHHH  186 (186)
T ss_dssp             SSHHHHHHHHHHHHTTCCGGGEEEEEEEECG--GGCHHHHHTTTCCCEEEEEECCC----
T ss_pred             HCHHHHHHHHHHHHCCCCEEEEEEEEEEECC--CCCHHHHHHCCCCCEEEEEECCCCCCC
T ss_conf             2569999999999879946889999999857--788488851689747998721444479


Done!