HHsearch results for GI: 254780238 and protein with PDBid: 2j01_S

>2j01_S 50S ribosomal protein L18; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: c.55.4.1 PDB: 1vsp_M 2hgj_R 2hgq_R 2hgu_R 1vsa_M 2j03_S 2jl6_S 2jl8_S 2v47_S 2v49_S 2wdi_S 2wdj_S 2wdl_S 2wdn_S 2wh2_S 2wh4_S 2wrj_S 2wrl_S 2wro_S 2wrr_S ...
Probab=95.17  E-value=0.028  Score=33.48  Aligned_cols=86  Identities=21%  Similarity=0.218  Sum_probs=58.1

Q ss_pred             CCEEEEEEECCCCEEEEEECCC-CCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEEC-CCC-CH
Q ss_conf             5218999917987799997089-98899740444355775433520378999999999998698199999977-998-67
Q gi|254780238|r   17 VSGRAHVVSTFNNTRITITDPH-GNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSG-LGA-GR   93 (129)
Q Consensus        17 ~~GiihI~~t~NNTiitlTd~~-Gn~i~~~S~G~~gfkg~kk~t~~Aa~~~a~~~~~~~~~~gi~~v~v~ikG-~G~-GR   93 (129)
                      ....+.|+-|.+|....+.|.. |.++..+|+=...+++   ....||+.+++.+++++.+.||+.|. +=+| +=. ||
T Consensus        22 ~~pRL~V~rSnkhiyaQiIdd~~~~tl~s~St~~k~~k~---~n~~aA~~vG~~ia~ka~~~gI~~vv-FDR~g~~yhGr   97 (112)
T 2j01_S           22 GRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKG---NKTEVARQVGRALAEKALALGIKQVA-FDRGPYKYHGR   97 (112)
T ss_dssp             SSCEEECCBCSSCBCEEEEETTTTEEEEEECSTTTCCCS---CHHHHHHHHHHHHHHHHHHTSCCCCB-CCCSTTCSSSS
T ss_pred             CCCEEEEEECCCEEEEEEEECCCCCEEEEEECCCCCCCC---CHHHHHHHHHHHHHHHHHHCCCCEEE-ECCCCCCCHHH
T ss_conf             987599997088369999977998685211041001358---85999999999999999986998899-74799720249


Q ss_pred             -HHHHHHHHHCCCE
Q ss_conf             -8887787636936
Q gi|254780238|r   94 -DSALRALRAIGFT  106 (129)
Q Consensus        94 -~~~ik~l~~~glk  106 (129)
                       .++..++...||+
T Consensus        98 vka~ad~~R~~Gl~  111 (112)
T 2j01_S           98 VKALAEGAREGGLE  111 (112)
T ss_dssp             CCCCSSCTTCC---
T ss_pred             HHHHHHHHHHCCCC
T ss_conf             99999999983899