HHSEARCH alignment of GI: 254780238 and SCOP domain: d2uubk1

Alignment
>d2uubk1 c.55.4.1 (K:11-129) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
Probab=100.00  E-value=0  Score=302.01  Aligned_cols=116  Identities=52%  Similarity=0.868  Sum_probs=114.0

Q ss_pred             EEECCCEEEEEEECCCCEEEEEECCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC
Q ss_conf             01225218999917987799997089988997404443557754335203789999999999986981999999779986
Q gi|254780238|r   13 RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAG   92 (129)
Q Consensus        13 ~~~i~~GiihI~~t~NNTiitlTd~~Gn~i~~~S~G~~gfkg~kk~t~~Aa~~~a~~~~~~~~~~gi~~v~v~ikG~G~G   92 (129)
                      +++++.|++||++|+|||||||||++||+++|+|+|++||||++|+||||||++++.++++++++||+.|+|+++|+|+|
T Consensus         1 k~~~~~GivhI~~t~NNT~itlTD~~Gn~i~~~S~G~~gfkg~rk~t~~Aa~~~a~~~~~k~~~~g~~~v~v~~kG~G~g   80 (119)
T d2uubk1           1 KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAG   80 (119)
T ss_dssp             CCCCSEEEEEEEECSSCEEEEEECTTSCEEEEEETTTSSCCSGGGGSHHHHHHHHHHHHHHHHTTTCCEEEEEEECCCTT
T ss_pred             CCCCCCCEEEEEECCCCEEEEEECCCCCEEEEEECCCCEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC
T ss_conf             96042538999923688999998799999999844620006643345257899999999999984981999999868999


Q ss_pred             HHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCC
Q ss_conf             788877876369369999963889888868888678
Q gi|254780238|r   93 RDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR  128 (129)
Q Consensus        93 R~~~ik~l~~~glkI~~I~D~T~ip~nGcRp~K~RR  128 (129)
                      |++++++|+..|++|++|+|+||+|||||||||+||
T Consensus        81 R~~~ik~l~~~g~kI~~I~D~T~iphnGcRp~K~RR  116 (119)
T d2uubk1          81 REQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR  116 (119)
T ss_dssp             HHHHHHHHHTSSSEEEECEECCCCCSSCSCCCGGGC
T ss_pred             HHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCC
T ss_conf             399999998789889999989999989989898887


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Translational machinery components
family: Ribosomal protein L18 and S11
domain: Ribosomal protein S11
species: Thermus thermophilus [TaxId: 274]