BLAST/PSIBLAST alignment of GI: 254780238 and GI: 27380488 at iteration 1
>gi|27380488|ref|NP_772017.1| 30S ribosomal protein S11 [Bradyrhizobium japonicum USDA 110] Length = 129
>gi|30179750|sp|P59370|RS11_BRAJA RecName: Full=30S ribosomal protein S11 Length = 129
>gi|27353652|dbj|BAC50642.1| 30S ribosomal protein S11 [Bradyrhizobium japonicum USDA 110] Length = 129
 Score =  184 bits (466), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 104/129 (80%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNI SG AHV S+FNNT ITITD  GNTIAWSS   +GF GSRK++P
Sbjct: 1   MGKEATRVRRRERKNIASGVAHVNSSFNNTTITITDAQGNTIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D S KAQ HGM +LEV+V+G G+GR+SALRAL+A GFT+ SI DVT I HNG
Sbjct: 61  YAAQVAAEDVSKKAQEHGMRTLEVEVAGPGSGRESALRALQAAGFTVTSIRDVTTIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129