BLAST/PSIBLAST alignment of GI: 254780238 and GI: 319405875 at iteration 1
>gi|319405875|emb|CBI79507.1| 30S ribosomal protein S11 [Bartonella sp. AR 15-3] Length = 129
 Score =  182 bits (463), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 103/129 (79%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKN+ SG  H+ STFNNT ITITDP G+TIAWSS    GF GSRK++P
Sbjct: 1   MAKEATRVRRRERKNVSSGVVHINSTFNNTMITITDPQGHTIAWSSAGAQGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +DC+ KAQ HGM SLEV+V G GAGR+SALRAL+++GF I SI DVT I HNG
Sbjct: 61  FAAQVAAEDCAKKAQEHGMRSLEVEVCGPGAGRESALRALQSVGFLITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129