BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780238|ref|YP_003064651.1| 30S ribosomal protein S11
[Candidatus Liberibacter asiaticus str. psy62]
         (129 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780238|ref|YP_003064651.1| 30S ribosomal protein S11 [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254039915|gb|ACT56711.1| 30S ribosomal protein S11 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 129

 Score =  262 bits (669), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 129/129 (100%), Positives = 129/129 (100%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP
Sbjct: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG
Sbjct: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRRI
Sbjct: 121 CRPRKRRRI 129


>gi|315122795|ref|YP_004063284.1| 30S ribosomal protein S11 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496197|gb|ADR52796.1| 30S ribosomal protein S11 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 129

 Score =  255 bits (651), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 125/129 (96%), Positives = 127/129 (98%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           MPKSP+R+RNRERKNIVSG AHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP
Sbjct: 1   MPKSPARVRNRERKNIVSGCAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG
Sbjct: 61  FAAQVAADDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRRI
Sbjct: 121 CRPRKRRRI 129


>gi|115525562|ref|YP_782473.1| 30S ribosomal protein S11 [Rhodopseudomonas palustris BisA53]
 gi|122295430|sp|Q07KP1|RS11_RHOP5 RecName: Full=30S ribosomal protein S11
 gi|115519509|gb|ABJ07493.1| SSU ribosomal protein S11P [Rhodopseudomonas palustris BisA53]
          Length = 129

 Score =  184 bits (468), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 89/129 (68%), Positives = 104/129 (80%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +RIR RERKNI SG AHV S+FNNT ITITD  GNTIAWSS   +GF GSRK++P
Sbjct: 1   MAKEATRIRRRERKNIASGIAHVNSSFNNTTITITDAQGNTIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D S KAQ HGM +LEV+V+G G+GR+SALRAL+A GFT+ SI DVT I HNG
Sbjct: 61  YAAQVAAEDVSKKAQEHGMRTLEVEVAGPGSGRESALRALQAAGFTVTSIRDVTTIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|148256369|ref|YP_001240954.1| 30S ribosomal protein S11 [Bradyrhizobium sp. BTAi1]
 gi|166231801|sp|A5ELK4|RS11_BRASB RecName: Full=30S ribosomal protein S11
 gi|146408542|gb|ABQ37048.1| SSU ribosomal protein S11P [Bradyrhizobium sp. BTAi1]
          Length = 129

 Score =  184 bits (467), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 104/129 (80%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNI SG AHV S+FNNT ITITD  GNTIAWSS   +GF GSRK++P
Sbjct: 1   MAKEATRVRRRERKNIASGVAHVNSSFNNTTITITDAQGNTIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D S KAQ HGM +LEV+V+G G+GR+SALRAL+A GFT+ SI DVT I HNG
Sbjct: 61  YAAQVAAEDVSKKAQEHGMRTLEVEVAGPGSGRESALRALQAAGFTVTSIRDVTTIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|27380488|ref|NP_772017.1| 30S ribosomal protein S11 [Bradyrhizobium japonicum USDA 110]
 gi|30179750|sp|P59370|RS11_BRAJA RecName: Full=30S ribosomal protein S11
 gi|27353652|dbj|BAC50642.1| 30S ribosomal protein S11 [Bradyrhizobium japonicum USDA 110]
          Length = 129

 Score =  184 bits (466), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 104/129 (80%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNI SG AHV S+FNNT ITITD  GNTIAWSS   +GF GSRK++P
Sbjct: 1   MGKEATRVRRRERKNIASGVAHVNSSFNNTTITITDAQGNTIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D S KAQ HGM +LEV+V+G G+GR+SALRAL+A GFT+ SI DVT I HNG
Sbjct: 61  YAAQVAAEDVSKKAQEHGMRTLEVEVAGPGSGRESALRALQAAGFTVTSIRDVTTIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|90424914|ref|YP_533284.1| 30S ribosomal protein S11 [Rhodopseudomonas palustris BisB18]
 gi|123275057|sp|Q211H1|RS11_RHOPB RecName: Full=30S ribosomal protein S11
 gi|90106928|gb|ABD88965.1| SSU ribosomal protein S11P [Rhodopseudomonas palustris BisB18]
          Length = 129

 Score =  183 bits (465), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 104/129 (80%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNI SG AHV S+FNNT ITITD  GNTIAWSS   +GF GSRK++P
Sbjct: 1   MGKEATRVRRRERKNIASGIAHVNSSFNNTTITITDAQGNTIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D S KAQ HGM +LEV+V+G G+GR+SALRAL+A GFT+ SI DVT I HNG
Sbjct: 61  YAAQVAAEDVSKKAQEHGMRTLEVEVAGPGSGRESALRALQAAGFTVTSIRDVTTIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|299135234|ref|ZP_07028425.1| 30S ribosomal protein S11 [Afipia sp. 1NLS2]
 gi|298590211|gb|EFI50415.1| 30S ribosomal protein S11 [Afipia sp. 1NLS2]
          Length = 129

 Score =  183 bits (465), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 103/129 (79%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K   R+R RERKNI SG AHV S+FNNT ITITD  GNTIAWSS   +GF GSRK++P
Sbjct: 1   MAKEAGRVRRRERKNIASGIAHVNSSFNNTTITITDAQGNTIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D S KAQ HGM +LEV+V+G G+GR+SALRAL+A GFT+ SI DVT I HNG
Sbjct: 61  YAAQVAAEDVSKKAQEHGMRTLEVEVAGPGSGRESALRALQAAGFTVTSIRDVTTIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|217979116|ref|YP_002363263.1| 30S ribosomal protein S11 [Methylocella silvestris BL2]
 gi|254811033|sp|B8EIT4|RS11_METSB RecName: Full=30S ribosomal protein S11
 gi|217504492|gb|ACK51901.1| ribosomal protein S11 [Methylocella silvestris BL2]
          Length = 129

 Score =  183 bits (465), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 105/129 (81%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNIVSG AHV STFNNT ITITD  GNTI+WSS   +GF GSRK++P
Sbjct: 1   MAKEATRVRRRERKNIVSGVAHVNSTFNNTMITITDAQGNTISWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +DC+ KA  HGM +LEV+VSG G+GR+SALRAL+A GFT+ SI DVT I HNG
Sbjct: 61  YAAQMAAEDCARKAAEHGMRTLEVEVSGPGSGRESALRALQAAGFTVTSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|319899076|ref|YP_004159169.1| 30S ribosomal protein S11 [Bartonella clarridgeiae 73]
 gi|319403040|emb|CBI76595.1| 30S ribosomal protein S11 [Bartonella clarridgeiae 73]
          Length = 129

 Score =  182 bits (463), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 90/129 (69%), Positives = 102/129 (79%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNI SG  H+ STFNNT ITITD  GNTIAWSS    GF GSRK++P
Sbjct: 1   MAKEATRVRRRERKNISSGVVHINSTFNNTMITITDSQGNTIAWSSAGAQGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +DC+ KAQ HGM SLEV+V G GAGR+SALRAL+++GF I SI DVT I HNG
Sbjct: 61  FAAQVAAEDCAKKAQEHGMRSLEVEVCGPGAGRESALRALQSVGFLITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRRI
Sbjct: 121 CRPRKRRRI 129


>gi|182679002|ref|YP_001833148.1| 30S ribosomal protein S11 [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|226708332|sp|B2IF94|RS11_BEII9 RecName: Full=30S ribosomal protein S11
 gi|182634885|gb|ACB95659.1| ribosomal protein S11 [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 129

 Score =  182 bits (463), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 106/129 (82%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNIVSG AHV STFNNT ITITD  GNTI+WSS  ++GF GSRK++P
Sbjct: 1   MAKEATRVRRRERKNIVSGVAHVNSTFNNTMITITDAQGNTISWSSAGMMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +DC+ KA  HGM +LEV+VSG G+GR+SALRAL+A GFT+ SI DVT I HNG
Sbjct: 61  YAAQMAAEDCARKAVEHGMRTLEVEVSGPGSGRESALRALQAAGFTVTSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|319405875|emb|CBI79507.1| 30S ribosomal protein S11 [Bartonella sp. AR 15-3]
          Length = 129

 Score =  182 bits (463), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 103/129 (79%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKN+ SG  H+ STFNNT ITITDP G+TIAWSS    GF GSRK++P
Sbjct: 1   MAKEATRVRRRERKNVSSGVVHINSTFNNTMITITDPQGHTIAWSSAGAQGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +DC+ KAQ HGM SLEV+V G GAGR+SALRAL+++GF I SI DVT I HNG
Sbjct: 61  FAAQVAAEDCAKKAQEHGMRSLEVEVCGPGAGRESALRALQSVGFLITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|23012205|ref|ZP_00052349.1| COG0100: Ribosomal protein S11 [Magnetospirillum magnetotacticum
           MS-1]
 gi|188581393|ref|YP_001924838.1| 30S ribosomal protein S11 [Methylobacterium populi BJ001]
 gi|226708385|sp|B1Z770|RS11_METPB RecName: Full=30S ribosomal protein S11
 gi|179344891|gb|ACB80303.1| ribosomal protein S11 [Methylobacterium populi BJ001]
          Length = 129

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 104/129 (80%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K P+R+R RERKNIVSG AHV ++FNNT ITITD  GNTI+WSS   +GF GSRK++P
Sbjct: 1   MAKEPTRVRRRERKNIVSGVAHVNASFNNTMITITDAQGNTISWSSAGAMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D   KA  HGM +LEV+VSG G+GR+SALRAL+A GFT+ SI DVT I HNG
Sbjct: 61  YAAQVAAEDAGRKAAEHGMRTLEVEVSGPGSGRESALRALQAAGFTVTSIRDVTSIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|170748611|ref|YP_001754871.1| ribosomal protein S11 [Methylobacterium radiotolerans JCM 2831]
 gi|226708386|sp|B1LWQ1|RS11_METRJ RecName: Full=30S ribosomal protein S11
 gi|170655133|gb|ACB24188.1| ribosomal protein S11 [Methylobacterium radiotolerans JCM 2831]
          Length = 129

 Score =  181 bits (460), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 103/129 (79%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K P R+R RERKNIVSG AHV ++FNNT ITITD  GNTI+WSS   +GF GSRK++P
Sbjct: 1   MAKEPQRVRRRERKNIVSGVAHVNASFNNTMITITDAQGNTISWSSAGAMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D   KA  HGM +LEV+VSG G+GR+SALRAL+A GFT+ SI DVT I HNG
Sbjct: 61  YAAQVAAEDAGRKAAEHGMRTLEVEVSGPGSGRESALRALQAAGFTVTSIRDVTSIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|39936290|ref|NP_948566.1| 30S ribosomal protein S11 [Rhodopseudomonas palustris CGA009]
 gi|192292013|ref|YP_001992618.1| 30S ribosomal protein S11 [Rhodopseudomonas palustris TIE-1]
 gi|316933550|ref|YP_004108532.1| 30S ribosomal protein S11 [Rhodopseudomonas palustris DX-1]
 gi|59798742|sp|Q6N4V6|RS11_RHOPA RecName: Full=30S ribosomal protein S11; AltName: Full=RRP-S11
 gi|226708408|sp|B3QBV6|RS11_RHOPT RecName: Full=30S ribosomal protein S11
 gi|39650145|emb|CAE28668.1| 30S ribosomal protein S11 [Rhodopseudomonas palustris CGA009]
 gi|192285762|gb|ACF02143.1| ribosomal protein S11 [Rhodopseudomonas palustris TIE-1]
 gi|315601264|gb|ADU43799.1| 30S ribosomal protein S11 [Rhodopseudomonas palustris DX-1]
          Length = 129

 Score =  181 bits (459), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 103/129 (79%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +RIR RERKNI SG AHV S+FNNT ITITD  GN IAWSS   +GF GSRK++P
Sbjct: 1   MAKDATRIRRRERKNIASGIAHVNSSFNNTTITITDAQGNAIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D + KAQ HGM +LEV+V+G G+GR+SALRAL+A GFT+ SI DVT I HNG
Sbjct: 61  YAAQVAAEDVAKKAQEHGMRTLEVEVAGPGSGRESALRALQAAGFTVTSIRDVTTIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|92117121|ref|YP_576850.1| 30S ribosomal protein S11 [Nitrobacter hamburgensis X14]
 gi|122990229|sp|Q1QN07|RS11_NITHX RecName: Full=30S ribosomal protein S11
 gi|91800015|gb|ABE62390.1| SSU ribosomal protein S11P [Nitrobacter hamburgensis X14]
          Length = 130

 Score =  181 bits (458), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 86/127 (67%), Positives = 104/127 (81%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           ++ +R+R RERKNI SG AHV S+FNNT ITITD  GNTIAWSS   +GF GSRK++P+A
Sbjct: 4   EAATRVRRRERKNIASGVAHVNSSFNNTTITITDAQGNTIAWSSAGTMGFKGSRKSTPYA 63

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQVA +D S KAQ HGM +LEV+V+G G+GR+SALRAL+A GFT+ SI DVT I HNGCR
Sbjct: 64  AQVAAEDVSKKAQEHGMRTLEVEVAGPGSGRESALRALQAAGFTVTSIRDVTAIPHNGCR 123

Query: 123 PRKRRRI 129
           PRKRRR+
Sbjct: 124 PRKRRRV 130


>gi|319404402|emb|CBI78005.1| 30S ribosomal protein S11 [Bartonella rochalimae ATCC BAA-1498]
 gi|319407402|emb|CBI81053.1| 30S ribosomal protein S11 [Bartonella sp. 1-1C]
          Length = 129

 Score =  181 bits (458), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 89/129 (68%), Positives = 102/129 (79%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +RIR RERKNI SG  H+ STFNNT ITITD  G+TIAWSS    GF GSRK++P
Sbjct: 1   MAKEATRIRRRERKNISSGVVHINSTFNNTMITITDSQGHTIAWSSAGAQGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +DC+ KAQ HGM SLEV+V G GAGR+SALRAL+++GF I SI DVT I HNG
Sbjct: 61  FAAQVAAEDCAKKAQEHGMRSLEVEVCGPGAGRESALRALQSVGFLITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|222148389|ref|YP_002549346.1| 30S ribosomal protein S11 [Agrobacterium vitis S4]
 gi|254765360|sp|B9JVR0|RS11_AGRVS RecName: Full=30S ribosomal protein S11
 gi|221735377|gb|ACM36340.1| 30S ribosomal protein S11 [Agrobacterium vitis S4]
          Length = 129

 Score =  180 bits (457), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 101/129 (78%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNI SG AHV STFNNT ITITD  GN IAWSS    GF GSRK++P
Sbjct: 1   MAKEATRVRRRERKNISSGVAHVNSTFNNTMITITDAQGNAIAWSSAGAKGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +DC+ KAQ HGM SLEV+V G G+GR+SALRAL+A GF I SI DVT I HNG
Sbjct: 61  FAAQIAAEDCAKKAQEHGMKSLEVEVCGPGSGRESALRALQAAGFMITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRK+RR+
Sbjct: 121 CRPRKKRRV 129


>gi|86749438|ref|YP_485934.1| 30S ribosomal protein S11 [Rhodopseudomonas palustris HaA2]
 gi|123098751|sp|Q2IXN7|RS11_RHOP2 RecName: Full=30S ribosomal protein S11
 gi|86572466|gb|ABD07023.1| SSU ribosomal protein S11P [Rhodopseudomonas palustris HaA2]
          Length = 129

 Score =  180 bits (457), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 102/129 (79%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K   RIR RERKNI SG AHV S+FNNT ITITD  GN IAWSS   +GF GSRK++P
Sbjct: 1   MAKEAGRIRRRERKNIASGIAHVNSSFNNTTITITDAQGNAIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D + KAQ HGM +LEV+V+G G+GR+SALRAL+A GFT+ SI DVT I HNG
Sbjct: 61  YAAQVAAEDVAKKAQEHGMRTLEVEVAGPGSGRESALRALQASGFTVTSIRDVTTIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|75675579|ref|YP_318000.1| 30S ribosomal protein S11 [Nitrobacter winogradskyi Nb-255]
 gi|85715107|ref|ZP_01046091.1| 30S ribosomal protein S11 [Nitrobacter sp. Nb-311A]
 gi|91207663|sp|Q3SSU3|RS11_NITWN RecName: Full=30S ribosomal protein S11
 gi|74420449|gb|ABA04648.1| SSU ribosomal protein S11P [Nitrobacter winogradskyi Nb-255]
 gi|85698022|gb|EAQ35895.1| 30S ribosomal protein S11 [Nitrobacter sp. Nb-311A]
          Length = 130

 Score =  180 bits (457), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 86/127 (67%), Positives = 104/127 (81%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           ++ +R+R RERKNI SG AHV S+FNNT ITITD  GNTIAWSS   +GF GSRK++P+A
Sbjct: 4   EATTRVRRRERKNIASGIAHVNSSFNNTTITITDAQGNTIAWSSAGTMGFKGSRKSTPYA 63

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQVA +D S KAQ HGM +LEV+V+G G+GR+SALRAL+A GFT+ SI DVT I HNGCR
Sbjct: 64  AQVAAEDVSKKAQEHGMRTLEVEVAGPGSGRESALRALQAAGFTVTSIRDVTAIPHNGCR 123

Query: 123 PRKRRRI 129
           PRKRRR+
Sbjct: 124 PRKRRRV 130


>gi|17987063|ref|NP_539697.1| 30S ribosomal protein S11 [Brucella melitensis bv. 1 str. 16M]
 gi|23502087|ref|NP_698214.1| 30S ribosomal protein S11 [Brucella suis 1330]
 gi|62290121|ref|YP_221914.1| 30S ribosomal protein S11 [Brucella abortus bv. 1 str. 9-941]
 gi|82700044|ref|YP_414618.1| 30S ribosomal protein S11 [Brucella melitensis biovar Abortus 2308]
 gi|148560220|ref|YP_001259130.1| 30S ribosomal protein S11 [Brucella ovis ATCC 25840]
 gi|153009309|ref|YP_001370524.1| 30S ribosomal protein S11 [Ochrobactrum anthropi ATCC 49188]
 gi|161619165|ref|YP_001593052.1| 30S ribosomal protein S11 [Brucella canis ATCC 23365]
 gi|163843475|ref|YP_001627879.1| 30S ribosomal protein S11 [Brucella suis ATCC 23445]
 gi|189024359|ref|YP_001935127.1| Ribosomal protein S11 [Brucella abortus S19]
 gi|225627681|ref|ZP_03785718.1| 30S ribosomal protein S11 [Brucella ceti str. Cudo]
 gi|225852706|ref|YP_002732939.1| 30S ribosomal protein S11 [Brucella melitensis ATCC 23457]
 gi|237815629|ref|ZP_04594626.1| 30S ribosomal protein S11 [Brucella abortus str. 2308 A]
 gi|239832099|ref|ZP_04680428.1| 30S ribosomal protein S11 [Ochrobactrum intermedium LMG 3301]
 gi|254689430|ref|ZP_05152684.1| 30S ribosomal protein S11 [Brucella abortus bv. 6 str. 870]
 gi|254693915|ref|ZP_05155743.1| 30S ribosomal protein S11 [Brucella abortus bv. 3 str. Tulya]
 gi|254697565|ref|ZP_05159393.1| 30S ribosomal protein S11 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701951|ref|ZP_05163779.1| 30S ribosomal protein S11 [Brucella suis bv. 5 str. 513]
 gi|254704495|ref|ZP_05166323.1| 30S ribosomal protein S11 [Brucella suis bv. 3 str. 686]
 gi|254706609|ref|ZP_05168437.1| 30S ribosomal protein S11 [Brucella pinnipedialis M163/99/10]
 gi|254710281|ref|ZP_05172092.1| 30S ribosomal protein S11 [Brucella pinnipedialis B2/94]
 gi|254714278|ref|ZP_05176089.1| 30S ribosomal protein S11 [Brucella ceti M644/93/1]
 gi|254717715|ref|ZP_05179526.1| 30S ribosomal protein S11 [Brucella ceti M13/05/1]
 gi|254719268|ref|ZP_05181079.1| 30S ribosomal protein S11 [Brucella sp. 83/13]
 gi|254730459|ref|ZP_05189037.1| 30S ribosomal protein S11 [Brucella abortus bv. 4 str. 292]
 gi|256031775|ref|ZP_05445389.1| 30S ribosomal protein S11 [Brucella pinnipedialis M292/94/1]
 gi|256044860|ref|ZP_05447764.1| 30S ribosomal protein S11 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061290|ref|ZP_05451440.1| 30S ribosomal protein S11 [Brucella neotomae 5K33]
 gi|256113764|ref|ZP_05454568.1| 30S ribosomal protein S11 [Brucella melitensis bv. 3 str. Ether]
 gi|256159945|ref|ZP_05457663.1| 30S ribosomal protein S11 [Brucella ceti M490/95/1]
 gi|256255176|ref|ZP_05460712.1| 30S ribosomal protein S11 [Brucella ceti B1/94]
 gi|256257676|ref|ZP_05463212.1| 30S ribosomal protein S11 [Brucella abortus bv. 9 str. C68]
 gi|256263803|ref|ZP_05466335.1| ribosomal protein S11 [Brucella melitensis bv. 2 str. 63/9]
 gi|256369634|ref|YP_003107144.1| 30S ribosomal protein S11 [Brucella microti CCM 4915]
 gi|260168909|ref|ZP_05755720.1| 30S ribosomal protein S11 [Brucella sp. F5/99]
 gi|260546669|ref|ZP_05822408.1| ribosomal protein S11 [Brucella abortus NCTC 8038]
 gi|260565538|ref|ZP_05836022.1| ribosomal protein S11 [Brucella melitensis bv. 1 str. 16M]
 gi|260566261|ref|ZP_05836731.1| ribosomal protein S11 [Brucella suis bv. 4 str. 40]
 gi|260754953|ref|ZP_05867301.1| ribosomal protein S11 [Brucella abortus bv. 6 str. 870]
 gi|260758169|ref|ZP_05870517.1| ribosomal protein S11 [Brucella abortus bv. 4 str. 292]
 gi|260761995|ref|ZP_05874338.1| ribosomal protein S11 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883962|ref|ZP_05895576.1| ribosomal protein S11 [Brucella abortus bv. 9 str. C68]
 gi|261214206|ref|ZP_05928487.1| ribosomal protein S11 [Brucella abortus bv. 3 str. Tulya]
 gi|261219557|ref|ZP_05933838.1| ribosomal protein S11 [Brucella ceti M13/05/1]
 gi|261222372|ref|ZP_05936653.1| SSU ribosomal protein S11P [Brucella ceti B1/94]
 gi|261314069|ref|ZP_05953266.1| ribosomal protein S11 [Brucella pinnipedialis M163/99/10]
 gi|261317843|ref|ZP_05957040.1| ribosomal protein S11 [Brucella pinnipedialis B2/94]
 gi|261322052|ref|ZP_05961249.1| SSU ribosomal protein S11P [Brucella ceti M644/93/1]
 gi|261325297|ref|ZP_05964494.1| ribosomal protein S11 [Brucella neotomae 5K33]
 gi|261752518|ref|ZP_05996227.1| ribosomal protein S11 [Brucella suis bv. 5 str. 513]
 gi|261755177|ref|ZP_05998886.1| ribosomal protein S11 [Brucella suis bv. 3 str. 686]
 gi|261758401|ref|ZP_06002110.1| ribosomal protein S11 [Brucella sp. F5/99]
 gi|265984267|ref|ZP_06097002.1| ribosomal protein S11 [Brucella sp. 83/13]
 gi|265988873|ref|ZP_06101430.1| ribosomal protein S11 [Brucella pinnipedialis M292/94/1]
 gi|265991287|ref|ZP_06103844.1| ribosomal protein S11 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995124|ref|ZP_06107681.1| ribosomal protein S11 [Brucella melitensis bv. 3 str. Ether]
 gi|265998337|ref|ZP_06110894.1| ribosomal protein S11 [Brucella ceti M490/95/1]
 gi|294852545|ref|ZP_06793218.1| 30S ribosomal protein S11 [Brucella sp. NVSL 07-0026]
 gi|297248516|ref|ZP_06932234.1| 30S ribosomal protein S11 [Brucella abortus bv. 5 str. B3196]
 gi|306838019|ref|ZP_07470877.1| 30S ribosomal protein S11 [Brucella sp. NF 2653]
 gi|306840324|ref|ZP_07473096.1| 30S ribosomal protein S11 [Brucella sp. BO2]
 gi|306844113|ref|ZP_07476707.1| 30S ribosomal protein S11 [Brucella sp. BO1]
 gi|54039330|sp|P66351|RS11_BRUSU RecName: Full=30S ribosomal protein S11
 gi|54042107|sp|P66350|RS11_BRUME RecName: Full=30S ribosomal protein S11
 gi|75496694|sp|Q57CT1|RS11_BRUAB RecName: Full=30S ribosomal protein S11
 gi|91207732|sp|Q2YRT9|RS11_BRUA2 RecName: Full=30S ribosomal protein S11
 gi|166231802|sp|A5VQY3|RS11_BRUO2 RecName: Full=30S ribosomal protein S11
 gi|166231821|sp|A6X0E1|RS11_OCHA4 RecName: Full=30S ribosomal protein S11
 gi|189040403|sp|A9M5M6|RS11_BRUC2 RecName: Full=30S ribosomal protein S11
 gi|189040404|sp|B0CH08|RS11_BRUSI RecName: Full=30S ribosomal protein S11
 gi|226708336|sp|B2S656|RS11_BRUA1 RecName: Full=30S ribosomal protein S11
 gi|254765370|sp|C0RJH7|RS11_BRUMB RecName: Full=30S ribosomal protein S11
 gi|17982720|gb|AAL51961.1| ssu ribosomal protein s11p [Brucella melitensis bv. 1 str. 16M]
 gi|23348046|gb|AAN30129.1| ribosomal protein S11 [Brucella suis 1330]
 gi|62196253|gb|AAX74553.1| RpsK, ribosomal protein S11 [Brucella abortus bv. 1 str. 9-941]
 gi|82616145|emb|CAJ11188.1| Ribosomal protein S11 [Brucella melitensis biovar Abortus 2308]
 gi|148371477|gb|ABQ61456.1| ribosomal protein S11 [Brucella ovis ATCC 25840]
 gi|151561197|gb|ABS14695.1| ribosomal protein S11 [Ochrobactrum anthropi ATCC 49188]
 gi|161335976|gb|ABX62281.1| 30S ribosomal protein S11 [Brucella canis ATCC 23365]
 gi|163674198|gb|ABY38309.1| 30S ribosomal protein S11 [Brucella suis ATCC 23445]
 gi|189019931|gb|ACD72653.1| Ribosomal protein S11 [Brucella abortus S19]
 gi|225617686|gb|EEH14731.1| 30S ribosomal protein S11 [Brucella ceti str. Cudo]
 gi|225641071|gb|ACO00985.1| 30S ribosomal protein S11 [Brucella melitensis ATCC 23457]
 gi|237788927|gb|EEP63138.1| 30S ribosomal protein S11 [Brucella abortus str. 2308 A]
 gi|239824366|gb|EEQ95934.1| 30S ribosomal protein S11 [Ochrobactrum intermedium LMG 3301]
 gi|255999796|gb|ACU48195.1| 30S ribosomal protein S11 [Brucella microti CCM 4915]
 gi|260095719|gb|EEW79596.1| ribosomal protein S11 [Brucella abortus NCTC 8038]
 gi|260151606|gb|EEW86700.1| ribosomal protein S11 [Brucella melitensis bv. 1 str. 16M]
 gi|260155779|gb|EEW90859.1| ribosomal protein S11 [Brucella suis bv. 4 str. 40]
 gi|260668487|gb|EEX55427.1| ribosomal protein S11 [Brucella abortus bv. 4 str. 292]
 gi|260672427|gb|EEX59248.1| ribosomal protein S11 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675061|gb|EEX61882.1| ribosomal protein S11 [Brucella abortus bv. 6 str. 870]
 gi|260873490|gb|EEX80559.1| ribosomal protein S11 [Brucella abortus bv. 9 str. C68]
 gi|260915813|gb|EEX82674.1| ribosomal protein S11 [Brucella abortus bv. 3 str. Tulya]
 gi|260920956|gb|EEX87609.1| SSU ribosomal protein S11P [Brucella ceti B1/94]
 gi|260924646|gb|EEX91214.1| ribosomal protein S11 [Brucella ceti M13/05/1]
 gi|261294742|gb|EEX98238.1| SSU ribosomal protein S11P [Brucella ceti M644/93/1]
 gi|261297066|gb|EEY00563.1| ribosomal protein S11 [Brucella pinnipedialis B2/94]
 gi|261301277|gb|EEY04774.1| ribosomal protein S11 [Brucella neotomae 5K33]
 gi|261303095|gb|EEY06592.1| ribosomal protein S11 [Brucella pinnipedialis M163/99/10]
 gi|261738385|gb|EEY26381.1| ribosomal protein S11 [Brucella sp. F5/99]
 gi|261742271|gb|EEY30197.1| ribosomal protein S11 [Brucella suis bv. 5 str. 513]
 gi|261744930|gb|EEY32856.1| ribosomal protein S11 [Brucella suis bv. 3 str. 686]
 gi|262552805|gb|EEZ08795.1| ribosomal protein S11 [Brucella ceti M490/95/1]
 gi|262766237|gb|EEZ12026.1| ribosomal protein S11 [Brucella melitensis bv. 3 str. Ether]
 gi|263002071|gb|EEZ14646.1| ribosomal protein S11 [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093931|gb|EEZ17865.1| ribosomal protein S11 [Brucella melitensis bv. 2 str. 63/9]
 gi|264661070|gb|EEZ31331.1| ribosomal protein S11 [Brucella pinnipedialis M292/94/1]
 gi|264662859|gb|EEZ33120.1| ribosomal protein S11 [Brucella sp. 83/13]
 gi|294821134|gb|EFG38133.1| 30S ribosomal protein S11 [Brucella sp. NVSL 07-0026]
 gi|297175685|gb|EFH35032.1| 30S ribosomal protein S11 [Brucella abortus bv. 5 str. B3196]
 gi|306275556|gb|EFM57288.1| 30S ribosomal protein S11 [Brucella sp. BO1]
 gi|306289723|gb|EFM60912.1| 30S ribosomal protein S11 [Brucella sp. BO2]
 gi|306406943|gb|EFM63164.1| 30S ribosomal protein S11 [Brucella sp. NF 2653]
 gi|326409231|gb|ADZ66296.1| Ribosomal protein S11 [Brucella melitensis M28]
 gi|326538939|gb|ADZ87154.1| 30S ribosomal protein S11 [Brucella melitensis M5-90]
          Length = 129

 Score =  180 bits (457), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 101/129 (78%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNI SG AHV STFNNT ITITD  GN IAWSS    GF GSRK++P
Sbjct: 1   MAKEATRVRRRERKNISSGVAHVNSTFNNTMITITDAQGNAIAWSSAGAQGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +DC+ KAQ HGM SLEV+V G G+GR+SALRAL+A GF I SI DVT I HNG
Sbjct: 61  FAAQIAAEDCAKKAQEHGMRSLEVEVCGPGSGRESALRALQAAGFVITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRK+RR+
Sbjct: 121 CRPRKKRRV 129


>gi|15965132|ref|NP_385485.1| 30S ribosomal protein S11 [Sinorhizobium meliloti 1021]
 gi|150396230|ref|YP_001326697.1| 30S ribosomal protein S11 [Sinorhizobium medicae WSM419]
 gi|227821778|ref|YP_002825748.1| 30S ribosomal protein S11 [Sinorhizobium fredii NGR234]
 gi|307314382|ref|ZP_07593988.1| 30S ribosomal protein S11 [Sinorhizobium meliloti BL225C]
 gi|307322094|ref|ZP_07601470.1| 30S ribosomal protein S11 [Sinorhizobium meliloti AK83]
 gi|29337192|sp|Q925W7|RS11_RHIME RecName: Full=30S ribosomal protein S11
 gi|166231835|sp|A6U882|RS11_SINMW RecName: Full=30S ribosomal protein S11
 gi|254811038|sp|C3MB02|RS11_RHISN RecName: Full=30S ribosomal protein S11
 gi|15074312|emb|CAC45958.1| Probable 30S ribosomal protein S11 [Sinorhizobium meliloti 1021]
 gi|16588801|gb|AAL26900.1| ribosomal protein S11 [Sinorhizobium meliloti]
 gi|150027745|gb|ABR59862.1| ribosomal protein S11 [Sinorhizobium medicae WSM419]
 gi|227340777|gb|ACP24995.1| 30S ribosomal protein S11 [Sinorhizobium fredii NGR234]
 gi|306892276|gb|EFN23086.1| 30S ribosomal protein S11 [Sinorhizobium meliloti AK83]
 gi|306899080|gb|EFN29722.1| 30S ribosomal protein S11 [Sinorhizobium meliloti BL225C]
          Length = 129

 Score =  180 bits (456), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 101/129 (78%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNI SG AHV S+FNNT ITITD  GN IAWSS    GF GSRK++P
Sbjct: 1   MAKEATRVRRRERKNITSGVAHVNSSFNNTMITITDAQGNAIAWSSAGAKGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +DC+ KAQ HGM SLEV+V G G+GR+SALRAL+A GF I SI DVT I HNG
Sbjct: 61  FAAQIAAEDCAKKAQEHGMKSLEVEVCGPGSGRESALRALQAAGFMITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRK+RR+
Sbjct: 121 CRPRKKRRV 129


>gi|319408742|emb|CBI82399.1| 30S ribosomal protein S11 [Bartonella schoenbuchensis R1]
          Length = 129

 Score =  179 bits (455), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 101/129 (78%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNI SG  H+ STFNNT ITITD  GN IAWSS    GF GSRK++P
Sbjct: 1   MAKEATRVRRRERKNISSGVVHINSTFNNTMITITDAQGNVIAWSSAGAQGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +DC+ KAQ HGM SLEV+V G G+GR+SALRAL+++GF I SI DVT I HNG
Sbjct: 61  FAAQVAAEDCAKKAQEHGMRSLEVEVCGPGSGRESALRALQSVGFVITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|49474381|ref|YP_032423.1| 30S ribosomal protein S11 [Bartonella quintana str. Toulouse]
 gi|59798701|sp|Q6FZE5|RS11_BARQU RecName: Full=30S ribosomal protein S11
 gi|49239885|emb|CAF26283.1| 30s ribosomal protein s11 [Bartonella quintana str. Toulouse]
          Length = 129

 Score =  179 bits (454), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 101/129 (78%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNI+SG  H+ STFNNT +TITD  GN IAWSS    GF GSRK++P
Sbjct: 1   MAKQATRVRRRERKNILSGVVHINSTFNNTMVTITDAQGNAIAWSSAGAQGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +DC+ KAQ HGM SLEV+V G GAGR+SALRAL++ GF I SI DVT I HNG
Sbjct: 61  FAAQVAAEDCARKAQEHGMRSLEVEVCGPGAGRESALRALQSAGFVITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|163868627|ref|YP_001609836.1| 30S ribosomal protein S11 [Bartonella tribocorum CIP 105476]
 gi|189040402|sp|A9IVZ7|RS11_BART1 RecName: Full=30S ribosomal protein S11
 gi|161018283|emb|CAK01841.1| 30S ribosomal protein S11 [Bartonella tribocorum CIP 105476]
          Length = 129

 Score =  179 bits (453), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 101/129 (78%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNI SG  H+ STFNNT ITITD  GN IAWSS    GF G+RK++P
Sbjct: 1   MAKEATRVRRRERKNISSGVVHINSTFNNTMITITDAQGNAIAWSSAGAQGFKGARKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +DC+ KAQ HGM SLEV+V G GAGR+SALRAL+++GF I SI DVT I HNG
Sbjct: 61  FAAQVAAEDCARKAQEHGMRSLEVEVCGPGAGRESALRALQSVGFVITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|170738680|ref|YP_001767335.1| 30S ribosomal protein S11 [Methylobacterium sp. 4-46]
 gi|226708387|sp|B0UHU6|RS11_METS4 RecName: Full=30S ribosomal protein S11
 gi|168192954|gb|ACA14901.1| ribosomal protein S11 [Methylobacterium sp. 4-46]
          Length = 129

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 103/129 (79%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +RIR RERKNIVSG AHV ++FNNT ITITD  GNTI+WSS   +GF GSRK++P
Sbjct: 1   MAKEATRIRRRERKNIVSGVAHVNASFNNTMITITDAQGNTISWSSAGAMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D   KA  HGM +LEV+VSG G+GR+SALRAL+A GFT+ SI DVT I HNG
Sbjct: 61  YAAQVAAEDAGRKAAEHGMRTLEVEVSGPGSGRESALRALQAAGFTVTSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|49475771|ref|YP_033812.1| 30S ribosomal protein S11 [Bartonella henselae str. Houston-1]
 gi|59798705|sp|Q6G2Y8|RS11_BARHE RecName: Full=30S ribosomal protein S11
 gi|49238578|emb|CAF27819.1| 30S ribosomal protein s11 [Bartonella henselae str. Houston-1]
          Length = 129

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 101/129 (78%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNI SG  H+ STFNNT ITITD  GN IAWSS    GF GSRK++P
Sbjct: 1   MAKEATRVRRRERKNISSGVVHINSTFNNTMITITDAQGNAIAWSSAGAQGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +DC+ KAQ HGM SLEV+V G G+GR+SALRAL+++GF I SI DVT I HNG
Sbjct: 61  FAAQVAAEDCARKAQEHGMRSLEVEVCGPGSGRESALRALQSVGFIITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|298291461|ref|YP_003693400.1| 30S ribosomal protein S11 [Starkeya novella DSM 506]
 gi|296927972|gb|ADH88781.1| 30S ribosomal protein S11 [Starkeya novella DSM 506]
          Length = 129

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 85/129 (65%), Positives = 103/129 (79%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +RI+ RERKNI SG AHV ++FNNT ITITD  GNTIAWSS   +GF GSRK++P
Sbjct: 1   MAKEAARIKRRERKNIASGVAHVNASFNNTMITITDAQGNTIAWSSAGAMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +DC+ KA  HGM ++EV+VSG G+GR+SALRA +A GFT+ SI DVT I HNG
Sbjct: 61  YAAQVAAEDCARKASEHGMRTIEVEVSGPGSGRESALRAFQAAGFTVTSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|220921922|ref|YP_002497223.1| 30S ribosomal protein S11 [Methylobacterium nodulans ORS 2060]
 gi|254811032|sp|B8IT34|RS11_METNO RecName: Full=30S ribosomal protein S11
 gi|219946528|gb|ACL56920.1| ribosomal protein S11 [Methylobacterium nodulans ORS 2060]
          Length = 129

 Score =  178 bits (451), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 86/129 (66%), Positives = 103/129 (79%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNIVSG AHV ++FNNT ITITD  GNTI+WSS   +GF GSRK++P
Sbjct: 1   MAKEATRVRRRERKNIVSGVAHVNASFNNTMITITDAQGNTISWSSAGAMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D   KA  HGM +LEV+VSG G+GR+SALRAL+A GFT+ SI DVT I HNG
Sbjct: 61  YAAQVAAEDAGRKAAEHGMRTLEVEVSGPGSGRESALRALQAAGFTVTSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|240850812|ref|YP_002972212.1| 30S ribosomal protein S11 [Bartonella grahamii as4aup]
 gi|240267935|gb|ACS51523.1| 30S ribosomal protein S11 [Bartonella grahamii as4aup]
          Length = 129

 Score =  177 bits (450), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 86/129 (66%), Positives = 101/129 (78%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNI SG  H+ STFNNT ITITD  GN IAWSS    GF G+RK++P
Sbjct: 1   MAKEATRVRRRERKNISSGVVHINSTFNNTMITITDAQGNAIAWSSAGAQGFKGARKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +DC+ KAQ HGM SLEV+V G G+GR+SALRAL+++GF I SI DVT I HNG
Sbjct: 61  FAAQVAAEDCARKAQEHGMRSLEVEVCGPGSGRESALRALQSVGFVITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|83858543|ref|ZP_00952065.1| 30S ribosomal protein S11 [Oceanicaulis alexandrii HTCC2633]
 gi|83853366|gb|EAP91218.1| 30S ribosomal protein S11 [Oceanicaulis alexandrii HTCC2633]
          Length = 129

 Score =  177 bits (450), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 103/129 (79%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K PSR+R RERKNI +G AHV ++FNNT ITITD  GN I+WSS   +GF GSRK++P
Sbjct: 1   MAKEPSRVRRRERKNITAGVAHVNASFNNTMITITDAQGNAISWSSAGAMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D   KAQ HG+ +LEVKVSG G+GR+SALRAL+++GFTI +I DVT I HNG
Sbjct: 61  YAAQVAAEDAGRKAQEHGVKTLEVKVSGPGSGRESALRALQSVGFTITTIHDVTSIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|304391479|ref|ZP_07373421.1| 30S ribosomal protein S11 [Ahrensia sp. R2A130]
 gi|303295708|gb|EFL90066.1| 30S ribosomal protein S11 [Ahrensia sp. R2A130]
          Length = 129

 Score =  175 bits (444), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 101/129 (78%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R++ +ERKNI SG AHV STFNNT ITITD  GNTIAWSS    GF GSRK++P
Sbjct: 1   MAKDAARVKRKERKNIASGVAHVNSTFNNTMITITDAQGNTIAWSSAGAQGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +D   KAQ+HGM +LEV+V G G+GR+SALRAL++IGF I SI DVT + HNG
Sbjct: 61  FAAQVAAEDAGKKAQDHGMKTLEVEVRGPGSGRESALRALQSIGFVITSIRDVTSVPHNG 120

Query: 121 CRPRKRRRI 129
           CR RK+RR+
Sbjct: 121 CRARKQRRV 129


>gi|258542050|ref|YP_003187483.1| 30S ribosomal protein S11 [Acetobacter pasteurianus IFO 3283-01]
 gi|329114195|ref|ZP_08242957.1| 30S ribosomal protein S11 [Acetobacter pomorum DM001]
 gi|256633128|dbj|BAH99103.1| SSU ribosomal protein S11P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636185|dbj|BAI02154.1| SSU ribosomal protein S11P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639240|dbj|BAI05202.1| SSU ribosomal protein S11P [Acetobacter pasteurianus IFO 3283-07]
 gi|256642294|dbj|BAI08249.1| SSU ribosomal protein S11P [Acetobacter pasteurianus IFO 3283-22]
 gi|256645349|dbj|BAI11297.1| SSU ribosomal protein S11P [Acetobacter pasteurianus IFO 3283-26]
 gi|256648404|dbj|BAI14345.1| SSU ribosomal protein S11P [Acetobacter pasteurianus IFO 3283-32]
 gi|256651457|dbj|BAI17391.1| SSU ribosomal protein S11P [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654448|dbj|BAI20375.1| SSU ribosomal protein S11P [Acetobacter pasteurianus IFO 3283-12]
 gi|326696271|gb|EGE47950.1| 30S ribosomal protein S11 [Acetobacter pomorum DM001]
          Length = 130

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 81/123 (65%), Positives = 101/123 (82%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           RIR +ERKNI+SG AHV+STFNNT ITI+D  GN I+WSS    GF GSRK++P+AAQVA
Sbjct: 8   RIRKKERKNIISGVAHVLSTFNNTMITISDAQGNAISWSSAGAQGFKGSRKSTPYAAQVA 67

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +D   KA+ HGM +LE++VSG G+GR+SALRAL+A+GFTI SI D+T + HNGCRPRKR
Sbjct: 68  AEDAGRKAREHGMETLEIEVSGPGSGRESALRALQAVGFTITSIRDMTPVPHNGCRPRKR 127

Query: 127 RRI 129
           RR+
Sbjct: 128 RRV 130


>gi|162149151|ref|YP_001603612.1| 30S ribosomal protein S11 [Gluconacetobacter diazotrophicus PAl 5]
 gi|189040417|sp|A9H3J3|RS11_GLUDA RecName: Full=30S ribosomal protein S11
 gi|161787728|emb|CAP57324.1| putative 30S ribosomal protein S11 [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 130

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 81/123 (65%), Positives = 101/123 (82%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           RIR +ERKNI+SG AHV+STFNNT ITI+D  GN IAWSS    GF GSRK++P+AAQVA
Sbjct: 8   RIRKKERKNIISGVAHVLSTFNNTMITISDAQGNAIAWSSAGAQGFKGSRKSTPYAAQVA 67

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +D   KA+ HGM +LE++VSG G+GR+SALRAL+A+GF+I SI D+T + HNGCRPRKR
Sbjct: 68  AEDAGRKAREHGMETLEIEVSGPGSGRESALRALQAVGFSITSIRDMTPVPHNGCRPRKR 127

Query: 127 RRI 129
           RR+
Sbjct: 128 RRV 130


>gi|209545105|ref|YP_002277334.1| 30S ribosomal protein S11 [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532782|gb|ACI52719.1| ribosomal protein S11 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 130

 Score =  174 bits (441), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 81/123 (65%), Positives = 101/123 (82%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           RIR +ERKNI+SG AHV+STFNNT ITI+D  GN IAWSS    GF GSRK++P+AAQVA
Sbjct: 8   RIRKKERKNIISGVAHVLSTFNNTMITISDVQGNAIAWSSAGAQGFKGSRKSTPYAAQVA 67

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +D   KA+ HGM +LE++VSG G+GR+SALRAL+A+GF+I SI D+T + HNGCRPRKR
Sbjct: 68  AEDAGRKAREHGMETLEIEVSGPGSGRESALRALQAVGFSITSIRDMTPVPHNGCRPRKR 127

Query: 127 RRI 129
           RR+
Sbjct: 128 RRV 130


>gi|58038832|ref|YP_190796.1| 30S ribosomal protein S11 [Gluconobacter oxydans 621H]
 gi|81352520|sp|Q5FU06|RS11_GLUOX RecName: Full=30S ribosomal protein S11
 gi|58001246|gb|AAW60140.1| SSU ribosomal protein S11P [Gluconobacter oxydans 621H]
          Length = 130

 Score =  174 bits (441), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 81/123 (65%), Positives = 100/123 (81%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           RIR +ERKNI+SG AHV+STFNNT ITI+D  GN IAWSS    GF GSRK++P+AAQVA
Sbjct: 8   RIRKKERKNIISGVAHVLSTFNNTMITISDAQGNAIAWSSSGAQGFKGSRKSTPYAAQVA 67

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +D   KA+ HGM +LE++VSG G+GR+SALRAL+A+GF I SI D+T + HNGCRPRKR
Sbjct: 68  AEDAGRKAREHGMETLEIEVSGPGSGRESALRALQAVGFNITSIRDMTPVPHNGCRPRKR 127

Query: 127 RRI 129
           RR+
Sbjct: 128 RRV 130


>gi|296116710|ref|ZP_06835320.1| 30S ribosomal protein S11 [Gluconacetobacter hansenii ATCC 23769]
 gi|295976922|gb|EFG83690.1| 30S ribosomal protein S11 [Gluconacetobacter hansenii ATCC 23769]
          Length = 130

 Score =  174 bits (440), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 101/123 (82%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           RIR +ERKNI+SG AHV+STFNNT ITI+D  GN IAWSS    GF GSRK++P+AAQVA
Sbjct: 8   RIRKKERKNIISGVAHVLSTFNNTMITISDAQGNAIAWSSAGAQGFKGSRKSTPYAAQVA 67

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +D   KA+ HGM +LE++VSG G+GR+SALRAL+A+GF+I +I D+T + HNGCRPRKR
Sbjct: 68  AEDAGRKAREHGMETLEIEVSGPGSGRESALRALQAVGFSITAIRDMTPVPHNGCRPRKR 127

Query: 127 RRI 129
           RR+
Sbjct: 128 RRV 130


>gi|83593997|ref|YP_427749.1| 30S ribosomal protein S11 [Rhodospirillum rubrum ATCC 11170]
 gi|91207675|sp|Q2RQY3|RS11_RHORT RecName: Full=30S ribosomal protein S11
 gi|83576911|gb|ABC23462.1| SSU ribosomal protein S11P [Rhodospirillum rubrum ATCC 11170]
          Length = 129

 Score =  173 bits (438), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 82/129 (63%), Positives = 99/129 (76%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K   ++R RERKNI SG AHV ++FNNT+ITITD  GN IAWSS    GF GSRK++P
Sbjct: 1   MAKPAQKLRRRERKNITSGIAHVSASFNNTKITITDVQGNAIAWSSAGAQGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D   KAQ HGM +LEV V G G+GR+SALRAL+++GF + SI DVT I HNG
Sbjct: 61  YAAQVAAEDAGRKAQEHGMKTLEVMVKGPGSGRESALRALQSVGFQVTSIKDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|163796896|ref|ZP_02190853.1| Ribosomal protein S11 [alpha proteobacterium BAL199]
 gi|159177885|gb|EDP62434.1| Ribosomal protein S11 [alpha proteobacterium BAL199]
          Length = 131

 Score =  173 bits (438), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 103/131 (78%), Gaps = 2/131 (1%)

Query: 1   MPKSPS--RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKN 58
           M K P+  R+R RE+KNI SG AHV+++FNNT ITITD  GN I+WSS   +GF GSRK+
Sbjct: 1   MAKQPTQARVRRREKKNITSGVAHVMASFNNTMITITDAQGNAISWSSAGTMGFKGSRKS 60

Query: 59  SPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAH 118
           +P+AAQVA +D   KA  HGM +LEV+VSG G+GR+SALRAL+A+GF + SI DVT I H
Sbjct: 61  TPYAAQVAAEDAGRKATEHGMKTLEVEVSGPGSGRESALRALQAVGFHVTSIRDVTPIPH 120

Query: 119 NGCRPRKRRRI 129
           NGCRPRKRRR+
Sbjct: 121 NGCRPRKRRRV 131


>gi|315497996|ref|YP_004086800.1| 30S ribosomal protein s11 [Asticcacaulis excentricus CB 48]
 gi|315416008|gb|ADU12649.1| 30S ribosomal protein S11 [Asticcacaulis excentricus CB 48]
          Length = 129

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 82/129 (63%), Positives = 101/129 (78%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K PSR++ RERKNI SG AHV ++FNNT ITITD  GN I+WSS   +GF GSRK++P
Sbjct: 1   MAKEPSRVKKRERKNITSGVAHVNASFNNTMITITDAQGNAISWSSAGHMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D   KA  HG+ +LEV V+G G+GR+SALRAL+A+GFTI +I DVT I HNG
Sbjct: 61  YAAQVAAEDAGKKAIEHGVKTLEVSVAGPGSGRESALRALQAVGFTITTIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|114704507|ref|ZP_01437415.1| 30S ribosomal protein S11 [Fulvimarina pelagi HTCC2506]
 gi|114539292|gb|EAU42412.1| 30S ribosomal protein S11 [Fulvimarina pelagi HTCC2506]
          Length = 128

 Score =  171 bits (432), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 98/123 (79%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R+R RERKNI +G AHV STFNNT ITITD  GN I+WSS    GF GSRK++PFAAQ+A
Sbjct: 6   RVRRRERKNISAGVAHVNSTFNNTLITITDAQGNAISWSSAGAQGFKGSRKSTPFAAQIA 65

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +DC+ KAQ HGM +LEV+V G G+GR+SALRAL+A GFTI SI DVT I HNG RPRK+
Sbjct: 66  AEDCAKKAQEHGMRTLEVEVCGPGSGRESALRALQAAGFTITSIRDVTPIPHNGVRPRKK 125

Query: 127 RRI 129
           RR+
Sbjct: 126 RRV 128


>gi|312115710|ref|YP_004013306.1| 30S ribosomal protein S11 [Rhodomicrobium vannielii ATCC 17100]
 gi|311220839|gb|ADP72207.1| 30S ribosomal protein S11 [Rhodomicrobium vannielii ATCC 17100]
          Length = 129

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 101/129 (78%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R++ RE+KNI SG AHV ++FNNT ITITD  GN I+WSS   +GF GSRK++P
Sbjct: 1   MAKEKARVKRREKKNIASGVAHVNASFNNTMITITDAQGNAISWSSSGAMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D   KAQ HGM ++E++VSG G+GR+SALRAL+A GF + SI DVT I HNG
Sbjct: 61  YAAQVAAEDAGRKAQEHGMRTIEIEVSGPGSGRESALRALQACGFQVTSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|85374440|ref|YP_458502.1| 30S ribosomal protein S11 [Erythrobacter litoralis HTCC2594]
 gi|123099514|sp|Q2N9D6|RS11_ERYLH RecName: Full=30S ribosomal protein S11
 gi|84787523|gb|ABC63705.1| ribosomal protein S11 [Erythrobacter litoralis HTCC2594]
          Length = 129

 Score =  170 bits (431), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/129 (63%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M + P R+R RERKNI SG AHV ++FNNT ITITD  GN I+WSS  ++GF GSRK++P
Sbjct: 1   MAREPGRVRRRERKNITSGVAHVNASFNNTMITITDAQGNAISWSSAGMMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA DD   KA  HG+ +LEV+V G G+GR+SALRAL+A+GFTI SI DVT I HNG
Sbjct: 61  YAAQVAADDAGRKAAEHGVRTLEVEVKGPGSGRESALRALQAVGFTITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 121 VRPSKRRRV 129


>gi|167645601|ref|YP_001683264.1| 30S ribosomal protein S11 [Caulobacter sp. K31]
 gi|189040406|sp|B0T2E5|RS11_CAUSK RecName: Full=30S ribosomal protein S11
 gi|167348031|gb|ABZ70766.1| ribosomal protein S11 [Caulobacter sp. K31]
          Length = 129

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 81/129 (62%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K P+R++ RERKNI SG AHV ++FNNT ITITD  GNTI+WSS   +GF GSRK++P
Sbjct: 1   MAKEPARVKKRERKNITSGVAHVNASFNNTMITITDAQGNTISWSSAGAMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KA  HG+ +LEV VSG G+GR+SALRAL+A G TI +I DVT I HNG
Sbjct: 61  YAAQMAAEDAGKKAAEHGVKTLEVNVSGPGSGRESALRALQAAGMTITTIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|16125520|ref|NP_420084.1| 30S ribosomal protein S11 [Caulobacter crescentus CB15]
 gi|221234266|ref|YP_002516702.1| 30S ribosomal protein S11 [Caulobacter crescentus NA1000]
 gi|33112614|sp|Q9A8T0|RS11_CAUCR RecName: Full=30S ribosomal protein S11
 gi|254765374|sp|B8H4F7|RS11_CAUCN RecName: Full=30S ribosomal protein S11
 gi|13422604|gb|AAK23252.1| ribosomal protein S11 [Caulobacter crescentus CB15]
 gi|220963438|gb|ACL94794.1| SSU ribosomal protein S11P [Caulobacter crescentus NA1000]
          Length = 129

 Score =  170 bits (431), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 81/129 (62%), Positives = 101/129 (78%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K P+R++ RERKNI SG AHV ++FNNT ITITD  GNTI+WSS  ++GF GSRK++P
Sbjct: 1   MAKEPARVKRRERKNITSGVAHVNASFNNTMITITDAQGNTISWSSAGMMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KA  HG+ +LEV VSG G+GR+SALRAL+A G TI +I DVT I HNG
Sbjct: 61  YAAQMAAEDAGKKAAEHGVKTLEVNVSGPGSGRESALRALQAAGMTITTIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|197104719|ref|YP_002130096.1| ribosomal protein S11 [Phenylobacterium zucineum HLK1]
 gi|226708395|sp|B4R8P0|RS11_PHEZH RecName: Full=30S ribosomal protein S11
 gi|196478139|gb|ACG77667.1| ribosomal protein S11 [Phenylobacterium zucineum HLK1]
          Length = 129

 Score =  170 bits (430), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 102/129 (79%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K P+R++ RERKNI SG AHV ++FNNT +TITD  GNTI+WSS  ++GF GSRK++P
Sbjct: 1   MAKEPARVKRRERKNITSGVAHVNASFNNTMVTITDAQGNTISWSSAGLMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KA  HG+ +LEV VSG G+GR+SALRAL+A+G TI +I DVT I HNG
Sbjct: 61  YAAQMAAEDAGRKAAEHGVRTLEVNVSGPGSGRESALRALQAVGMTITTIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|209884836|ref|YP_002288693.1| ribosomal protein S11 [Oligotropha carboxidovorans OM5]
 gi|209873032|gb|ACI92828.1| ribosomal protein S11 [Oligotropha carboxidovorans OM5]
          Length = 134

 Score =  169 bits (429), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 81/116 (69%), Positives = 95/116 (81%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           KNI SG AHV S+FNNT ITITD  GNTIAWSS   +GF GSRK++P+AAQVA +D S K
Sbjct: 19  KNIASGVAHVNSSFNNTTITITDAQGNTIAWSSAGTMGFKGSRKSTPYAAQVAAEDVSKK 78

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           AQ HGM +LEV+V+G G+GR+SALRAL+A GFT+ SI DVT I HNGCRPRKRRR+
Sbjct: 79  AQEHGMRTLEVEVAGPGSGRESALRALQAAGFTVTSIRDVTTIPHNGCRPRKRRRV 134


>gi|295688929|ref|YP_003592622.1| 30S ribosomal protein S11 [Caulobacter segnis ATCC 21756]
 gi|295430832|gb|ADG10004.1| 30S ribosomal protein S11 [Caulobacter segnis ATCC 21756]
          Length = 129

 Score =  169 bits (429), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 81/129 (62%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K P R++ RERKNI SG AHV ++FNNT ITITD  GNTI+WSS  ++GF GSRK++P
Sbjct: 1   MAKEPGRVKRRERKNITSGVAHVNASFNNTMITITDAQGNTISWSSAGMMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KA  HG+ +LEV VSG G+GR+SALRAL+A G TI +I DVT I HNG
Sbjct: 61  YAAQMAAEDAGKKAAEHGVKTLEVNVSGPGSGRESALRALQAAGMTITTIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|146340080|ref|YP_001205128.1| 30S ribosomal protein S11 [Bradyrhizobium sp. ORS278]
 gi|152060578|sp|A4YSL5|RS11_BRASO RecName: Full=30S ribosomal protein S11
 gi|146192886|emb|CAL76891.1| 30S ribosomal subunit protein S11 [Bradyrhizobium sp. ORS278]
          Length = 129

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 104/129 (80%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNI SG AHV S+FNNT ITITD  GNTIAWSS   +GF GSRK++P
Sbjct: 1   MAKEAARVRRRERKNIASGVAHVNSSFNNTTITITDAQGNTIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D S KAQ HGM +LEV+V+G G+GR+SALRAL+A GFT+ SI DVT I HNG
Sbjct: 61  YAAQVAAEDVSKKAQEHGMRTLEVEVAGPGSGRESALRALQAAGFTVTSIRDVTTIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|294085981|ref|YP_003552741.1| 30S ribosomal protein S11 [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665556|gb|ADE40657.1| Ribosomal protein S11 [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 131

 Score =  169 bits (427), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 102/131 (77%), Gaps = 2/131 (1%)

Query: 1   MPKSPS--RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKN 58
           M K PS  R+R RERKNI +G AHV STFNNT ITITD  GN IAW+S   +GF GSRK+
Sbjct: 1   MAKQPSQGRVRRRERKNITNGVAHVNSTFNNTMITITDVQGNAIAWASAGGMGFKGSRKS 60

Query: 59  SPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAH 118
           +PFAAQ+A +D   KA +HGM SL+V+V G G+GR+SALRAL+++GF + SI DVT I H
Sbjct: 61  TPFAAQMAAEDAGRKAADHGMKSLDVQVRGPGSGRESALRALQSVGFNVTSIRDVTPIPH 120

Query: 119 NGCRPRKRRRI 129
           NGCRPRKRRR+
Sbjct: 121 NGCRPRKRRRV 131


>gi|114570322|ref|YP_757002.1| 30S ribosomal protein S11 [Maricaulis maris MCS10]
 gi|122315804|sp|Q0ANS3|RS11_MARMM RecName: Full=30S ribosomal protein S11
 gi|114340784|gb|ABI66064.1| SSU ribosomal protein S11P [Maricaulis maris MCS10]
          Length = 129

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K   R++ RERKNI SG AHV ++FNNT +TITD  GN I+WSS   +GF GSRK++P
Sbjct: 1   MAKDTGRVKRRERKNITSGVAHVSASFNNTMVTITDAQGNAISWSSAGHMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KA  HGM ++EVKVSG G+GR+SALRAL+++GFTI +I DVT I HNG
Sbjct: 61  YAAQMAAEDAGKKAMEHGMKTIEVKVSGPGSGRESALRALQSVGFTITTIQDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|302382642|ref|YP_003818465.1| 30S ribosomal protein S11 [Brevundimonas subvibrioides ATCC 15264]
 gi|302193270|gb|ADL00842.1| 30S ribosomal protein S11 [Brevundimonas subvibrioides ATCC 15264]
          Length = 129

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K P R++ RERKNI SG AHV ++FNNT ITITD  GN I+WSS   +GF GSRK++P
Sbjct: 1   MAKEPGRVKKRERKNITSGVAHVNASFNNTMITITDAQGNAISWSSAGHMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ HG+ +LEV VSG G+GR+SALRAL+++G TI +I DVT + HNG
Sbjct: 61  YAAQMAAEDAGKKAQEHGVKTLEVNVSGPGSGRESALRALQSVGLTITTIRDVTPMPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|114327241|ref|YP_744398.1| 30S ribosomal protein S11 [Granulibacter bethesdensis CGDNIH1]
 gi|122327780|sp|Q0BUM7|RS11_GRABC RecName: Full=30S ribosomal protein S11
 gi|114315415|gb|ABI61475.1| SSU ribosomal protein S11P [Granulibacter bethesdensis CGDNIH1]
          Length = 131

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 97/124 (78%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           SR R +ERKNI SG AHV +TFNNT ITI+D  GN IAWSS    GF GSRK++P+AAQV
Sbjct: 8   SRPRKKERKNISSGVAHVAATFNNTMITISDAQGNAIAWSSAGAQGFKGSRKSTPYAAQV 67

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +D   KA+ HGM +LE++VSG G+GR+SALRAL+A+GF I +I D T I HNGCRPRK
Sbjct: 68  AAEDAGRKAREHGMETLEIEVSGPGSGRESALRALQAVGFAITAIRDTTPIPHNGCRPRK 127

Query: 126 RRRI 129
           RRR+
Sbjct: 128 RRRV 131


>gi|110634007|ref|YP_674215.1| 30S ribosomal protein S11 [Mesorhizobium sp. BNC1]
 gi|123353646|sp|Q11HS5|RS11_MESSB RecName: Full=30S ribosomal protein S11
 gi|110284991|gb|ABG63050.1| SSU ribosomal protein S11P [Chelativorans sp. BNC1]
          Length = 129

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/116 (71%), Positives = 94/116 (81%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           KNI SG AHV STFNNT ITITD  GN IAWSS    GF GSRK++PFAAQVA +DC+ K
Sbjct: 14  KNISSGVAHVNSTFNNTMITITDAQGNAIAWSSAGAQGFKGSRKSTPFAAQVAAEDCARK 73

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           AQ HGM +LEV+VSG G+GR+SALRAL+A GFTI SI DVT I HNGCRPRK+RR+
Sbjct: 74  AQEHGMRTLEVEVSGPGSGRESALRALQAAGFTITSIRDVTPIPHNGCRPRKKRRV 129


>gi|332186888|ref|ZP_08388630.1| 30S ribosomal protein S11 [Sphingomonas sp. S17]
 gi|332013221|gb|EGI55284.1| 30S ribosomal protein S11 [Sphingomonas sp. S17]
          Length = 129

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 99/129 (76%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M + P RIR RERKNI +G AHV ++FNNT ITITD  GN I+WSS  ++GF GSRK++P
Sbjct: 1   MAREPQRIRRRERKNITAGVAHVNASFNNTMITITDAQGNAISWSSAGMMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D   KA  HG+ +LEV+V G G+GR+SALRAL+A+GF I SI DVT I HNG
Sbjct: 61  YAAQVAAEDAGKKAAEHGVRTLEVEVKGPGSGRESALRALQAVGFQITSIRDVTSIPHNG 120

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 121 VRPSKRRRV 129


>gi|260432471|ref|ZP_05786442.1| 30S ribosomal protein S11 [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416299|gb|EEX09558.1| 30S ribosomal protein S11 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 129

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  +R++ +ERKNI SG AHV STFNNT+I I+D  GN IAWSS   +GF GSRK++P
Sbjct: 1   MARDKTRVKRKERKNIASGVAHVNSTFNNTKILISDVQGNAIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ HG+ +LEV+V G G+GR+SALRAL A+GF I SI DVT IAHNG
Sbjct: 61  YAAQMAAEDAGRKAQEHGVKTLEVEVQGPGSGRESALRALAAVGFNITSIRDVTPIAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|329850230|ref|ZP_08265075.1| 30S ribosomal protein S11 [Asticcacaulis biprosthecum C19]
 gi|328840545|gb|EGF90116.1| 30S ribosomal protein S11 [Asticcacaulis biprosthecum C19]
          Length = 129

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  SR++ RERKNI SG AHV ++FNNT ITITD  GN ++WSS   +GF GSRK++P
Sbjct: 1   MAKDTSRVKKRERKNITSGVAHVNASFNNTMITITDAQGNAVSWSSAGAMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D   KA  HG+ +LEV V+G G+GR+SALRAL+A+GFTI +I DVT I HNG
Sbjct: 61  YAAQVAAEDAGKKAIEHGVKTLEVSVAGPGSGRESALRALQAVGFTITTIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|254420943|ref|ZP_05034667.1| ribosomal protein S11 [Brevundimonas sp. BAL3]
 gi|196187120|gb|EDX82096.1| ribosomal protein S11 [Brevundimonas sp. BAL3]
          Length = 129

 Score =  168 bits (425), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K P R++ RERKNI SG AHV ++FNNT +TITD  GN I+WSS   +GF GSRK++P
Sbjct: 1   MAKEPGRVKKRERKNITSGVAHVNASFNNTMVTITDAQGNAISWSSAGHMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ HG+ +LEV VSG G+GR+SALRAL+++G TI +I DVT + HNG
Sbjct: 61  YAAQMAAEDAGKKAQEHGVKTLEVNVSGPGSGRESALRALQSVGLTITTIRDVTPMPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|148554248|ref|YP_001261830.1| 30S ribosomal protein S11 [Sphingomonas wittichii RW1]
 gi|166231836|sp|A5V5X6|RS11_SPHWW RecName: Full=30S ribosomal protein S11
 gi|148499438|gb|ABQ67692.1| SSU ribosomal protein S11P [Sphingomonas wittichii RW1]
          Length = 129

 Score =  168 bits (425), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/129 (62%), Positives = 99/129 (76%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M + P RIR RERKNI +G AHV ++FNNT ITITD  GN IAWSS  ++GF GSRK++P
Sbjct: 1   MAREPQRIRRRERKNITAGVAHVNASFNNTMITITDAQGNAIAWSSAGMMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D   KA  HG+ +LEV+V G G+GR+SALRAL+A+GF I SI DVT I HNG
Sbjct: 61  YAAQVAAEDAGKKAAEHGVRTLEVEVKGPGSGRESALRALQAVGFHITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 121 VRPSKRRRV 129


>gi|300022564|ref|YP_003755175.1| 30S ribosomal protein S11 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524385|gb|ADJ22854.1| 30S ribosomal protein S11 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 133

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 97/123 (78%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           +++ RE+KNI SG AHV ++FNNT ITITD  GNTIAWSS    GF GSRK++P+AAQ+A
Sbjct: 11  KVKKREKKNITSGVAHVNASFNNTMITITDAQGNTIAWSSSGTKGFKGSRKSTPYAAQIA 70

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +D   KAQ HGM  LEV+V G G+GR+SALRAL+++GF I SI DVT I HNGCRPRKR
Sbjct: 71  AEDAGRKAQEHGMKVLEVEVCGPGSGRESALRALQSVGFQITSIRDVTPIPHNGCRPRKR 130

Query: 127 RRI 129
           RR+
Sbjct: 131 RRV 133


>gi|163851601|ref|YP_001639644.1| ribosomal protein S11 [Methylobacterium extorquens PA1]
 gi|218530410|ref|YP_002421226.1| 30S ribosomal protein S11 [Methylobacterium chloromethanicum CM4]
 gi|240138769|ref|YP_002963241.1| 30S ribosomal subunit protein S11 [Methylobacterium extorquens AM1]
 gi|254561369|ref|YP_003068464.1| 30S ribosomal subunit protein S11 [Methylobacterium extorquens DM4]
 gi|226708384|sp|A9W4R7|RS11_METEP RecName: Full=30S ribosomal protein S11
 gi|254811031|sp|B7L0S7|RS11_METC4 RecName: Full=30S ribosomal protein S11
 gi|163663206|gb|ABY30573.1| ribosomal protein S11 [Methylobacterium extorquens PA1]
 gi|218522713|gb|ACK83298.1| ribosomal protein S11 [Methylobacterium chloromethanicum CM4]
 gi|240008738|gb|ACS39964.1| 30S ribosomal subunit protein S11 [Methylobacterium extorquens AM1]
 gi|254268647|emb|CAX24606.1| 30S ribosomal subunit protein S11 [Methylobacterium extorquens DM4]
          Length = 129

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 105/129 (81%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K P+R+R RERKNIVSG AHV ++FNNT ITITD  GNTI+WSS   +GF GSRK++P
Sbjct: 1   MAKEPTRVRRRERKNIVSGVAHVAASFNNTMITITDAQGNTISWSSAGAMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D + KA  HGM +LEV+VSG G+GR+SALRAL+A GFT+ SI DVT I HNG
Sbjct: 61  YAAQVAAEDAARKASEHGMRTLEVEVSGPGSGRESALRALQAAGFTVTSIRDVTSIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|254475723|ref|ZP_05089109.1| ribosomal protein S11 [Ruegeria sp. R11]
 gi|214029966|gb|EEB70801.1| ribosomal protein S11 [Ruegeria sp. R11]
          Length = 129

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 101/129 (78%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  +RI+ +ERKNI SG AHV S+FNNT+I I+D  GN I+WSS   +GF GSRK++P
Sbjct: 1   MARDKTRIKRKERKNIASGVAHVNSSFNNTKILISDVQGNAISWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ+HG+ +LEV+V G G+GR+SALRAL AIGF I SI DVT IAHNG
Sbjct: 61  YAAQMAAEDAGKKAQDHGVKTLEVEVQGPGSGRESALRALAAIGFNITSIRDVTPIAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|254511417|ref|ZP_05123484.1| ribosomal protein S11 [Rhodobacteraceae bacterium KLH11]
 gi|221535128|gb|EEE38116.1| ribosomal protein S11 [Rhodobacteraceae bacterium KLH11]
          Length = 129

 Score =  167 bits (424), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  +R++ +ERKNI SG AHV STFNNT+I I+D  GN I+WSS   +GF GSRK++P
Sbjct: 1   MARDKTRVKRKERKNIASGVAHVNSTFNNTKILISDVQGNAISWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ HG+ +LEV+V G G+GR+SALRAL A+GF I SI DVT IAHNG
Sbjct: 61  YAAQMAAEDAGKKAQEHGVKTLEVEVQGPGSGRESALRALAAVGFNITSIRDVTPIAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|103486059|ref|YP_615620.1| 30S ribosomal protein S11 [Sphingopyxis alaskensis RB2256]
 gi|122985219|sp|Q1GVN5|RS11_SPHAL RecName: Full=30S ribosomal protein S11
 gi|98976136|gb|ABF52287.1| SSU ribosomal protein S11P [Sphingopyxis alaskensis RB2256]
          Length = 129

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 82/129 (63%), Positives = 98/129 (75%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M + P R+R RERKNI SG AHV +TFNNT ITITD  GN IAWSS  ++GF GSRK++P
Sbjct: 1   MAREPQRLRRRERKNISSGVAHVNATFNNTMITITDAQGNAIAWSSAGMMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQV  +D   KA  HG+ +LEV+V G GAGR+SALRAL+A+GF I SI DVT I HNG
Sbjct: 61  YAAQVCAEDAGKKAAEHGVRTLEVEVKGPGAGRESALRALQAVGFHITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 121 VRPAKRRRV 129


>gi|288958718|ref|YP_003449059.1| small subunit ribosomal protein S11 [Azospirillum sp. B510]
 gi|288911026|dbj|BAI72515.1| small subunit ribosomal protein S11 [Azospirillum sp. B510]
          Length = 132

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 97/123 (78%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R+R RERKNI +G AHV ++FNNT ITITD  GNTIAWSS   +GF GSRK++P+AAQVA
Sbjct: 10  RLRRRERKNITAGVAHVNASFNNTMITITDAQGNTIAWSSSGTMGFKGSRKSTPYAAQVA 69

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +D   KAQ HGM +LEV+V G G+GR+SALRAL++IGF I SI DVT I HNG RP K+
Sbjct: 70  AEDAGRKAQEHGMKTLEVEVKGPGSGRESALRALQSIGFQITSIRDVTPIPHNGVRPPKK 129

Query: 127 RRI 129
           RR+
Sbjct: 130 RRV 132


>gi|154253200|ref|YP_001414024.1| 30S ribosomal protein S11 [Parvibaculum lavamentivorans DS-1]
 gi|171769645|sp|A7HWT4|RS11_PARL1 RecName: Full=30S ribosomal protein S11
 gi|154157150|gb|ABS64367.1| ribosomal protein S11 [Parvibaculum lavamentivorans DS-1]
          Length = 129

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R++ +ERKNI SG AHV STFNNT ITI D  GN I+WSS  ++GF GSRK++P
Sbjct: 1   MAKEKTRVKRKERKNISSGVAHVNSTFNNTMITIADAQGNAISWSSAGLMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +D   KA  HGM +LEV+V G G+GR+SALRAL+++GFT+ +I DVT I HNG
Sbjct: 61  FAAQMAAEDAGKKAMEHGMRTLEVEVCGPGSGRESALRALQSVGFTVTTIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|254463913|ref|ZP_05077324.1| ribosomal protein S11 [Rhodobacterales bacterium Y4I]
 gi|206684821|gb|EDZ45303.1| ribosomal protein S11 [Rhodobacterales bacterium Y4I]
          Length = 129

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  SRI+ +ERKNI +G AHV S+FNNT+I I+D  GN I+WSS   +GF GSRK++P
Sbjct: 1   MARDKSRIKRKERKNIATGVAHVNSSFNNTKILISDVQGNAISWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ HG+ +LEV+V G G+GR+SALRAL A+GF I SI DVT IAHNG
Sbjct: 61  YAAQMAAEDAGKKAQEHGVKTLEVEVQGPGSGRESALRALAAVGFNITSIRDVTPIAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|15889219|ref|NP_354900.1| 30S ribosomal protein S11 [Agrobacterium tumefaciens str. C58]
 gi|325293313|ref|YP_004279177.1| 30S ribosomal protein S11 [Agrobacterium sp. H13-3]
 gi|48474523|sp|Q8UE40|RS11_AGRT5 RecName: Full=30S ribosomal protein S11
 gi|15157044|gb|AAK87685.1| 30S ribosomal protein S11 [Agrobacterium tumefaciens str. C58]
 gi|325061166|gb|ADY64857.1| 30S ribosomal protein S11 [Agrobacterium sp. H13-3]
          Length = 129

 Score =  166 bits (421), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 81/116 (69%), Positives = 92/116 (79%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           KNI SG AHV STFNNT ITITD  GN IAWSS    GF GSRK++PFAAQ+A +DC+ K
Sbjct: 14  KNITSGVAHVNSTFNNTMITITDAQGNAIAWSSAGAKGFKGSRKSTPFAAQIAAEDCAKK 73

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           AQ HGM SLEV+V G G+GR+SALRAL+A GF I SI DVT I HNGCRPRK+RR+
Sbjct: 74  AQEHGMKSLEVEVCGPGSGRESALRALQAAGFMITSIRDVTPIPHNGCRPRKKRRV 129


>gi|254470057|ref|ZP_05083461.1| ribosomal protein S11 [Pseudovibrio sp. JE062]
 gi|211960368|gb|EEA95564.1| ribosomal protein S11 [Pseudovibrio sp. JE062]
          Length = 122

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 95/122 (77%)

Query: 8   IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
           +R RERKNI SG AHV STFNNT ITITD  GN I+WSS   +GF GSRK++P+AAQVA 
Sbjct: 1   MRRRERKNISSGVAHVNSTFNNTMITITDAQGNAISWSSAGALGFKGSRKSTPYAAQVAA 60

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
           +D   KA  HGM +LEV+V G G+GR+SALRAL+A GF I SI DVT I HNGCRPRKRR
Sbjct: 61  EDAGRKAAEHGMRTLEVEVRGPGSGRESALRALQAAGFVITSIRDVTPIPHNGCRPRKRR 120

Query: 128 RI 129
           R+
Sbjct: 121 RV 122


>gi|209964063|ref|YP_002296978.1| 30S ribosomal protein S11 [Rhodospirillum centenum SW]
 gi|209957529|gb|ACI98165.1| ribosomal protein S11 [Rhodospirillum centenum SW]
          Length = 132

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 98/126 (77%)

Query: 4   SPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAA 63
           S +R+R RERKNI +G AHV ++FNNT ITITD  GN IAWSS   +GF GSRK++P+AA
Sbjct: 7   SAARLRRRERKNITAGVAHVNASFNNTMITITDAQGNAIAWSSAGTMGFKGSRKSTPYAA 66

Query: 64  QVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRP 123
           QVA +D   KAQ HGM +LEV+V G G+GR+SALRAL++IGF I SI DVT I HNG RP
Sbjct: 67  QVAAEDAGRKAQEHGMKTLEVEVKGPGSGRESALRALQSIGFQITSIRDVTPIPHNGVRP 126

Query: 124 RKRRRI 129
            K+RR+
Sbjct: 127 PKKRRV 132


>gi|126737031|ref|ZP_01752766.1| 30S ribosomal protein S11 [Roseobacter sp. SK209-2-6]
 gi|126721616|gb|EBA18319.1| 30S ribosomal protein S11 [Roseobacter sp. SK209-2-6]
          Length = 129

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 101/129 (78%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  +R++ +ERKNI +G AHV S+FNNT+I I+D  GN I+WSS   +GF GSRK++P
Sbjct: 1   MARDKTRVKKKERKNIATGVAHVNSSFNNTKILISDVQGNAISWSSAGSMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ+HG+ +LEV+V G G+GR+SALRAL AIGF I SI DVT IAHNG
Sbjct: 61  YAAQMAAEDAGKKAQDHGVKTLEVEVQGPGSGRESALRALAAIGFNITSIRDVTPIAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|86357328|ref|YP_469220.1| 30S ribosomal protein S11 [Rhizobium etli CFN 42]
 gi|116251563|ref|YP_767401.1| 30S ribosomal protein S11 [Rhizobium leguminosarum bv. viciae 3841]
 gi|190891378|ref|YP_001977920.1| 30S ribosomal protein S11 [Rhizobium etli CIAT 652]
 gi|209548958|ref|YP_002280875.1| 30S ribosomal protein S11 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|218508352|ref|ZP_03506230.1| 30S ribosomal protein S11 [Rhizobium etli Brasil 5]
 gi|218516293|ref|ZP_03513133.1| 30S ribosomal protein S11 [Rhizobium etli 8C-3]
 gi|218674112|ref|ZP_03523781.1| 30S ribosomal protein S11 [Rhizobium etli GR56]
 gi|218679852|ref|ZP_03527749.1| 30S ribosomal protein S11 [Rhizobium etli CIAT 894]
 gi|222085698|ref|YP_002544228.1| 30S ribosomal protein S11 [Agrobacterium radiobacter K84]
 gi|241204188|ref|YP_002975284.1| 30S ribosomal protein S11 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|123081960|sp|Q1MIB8|RS11_RHIL3 RecName: Full=30S ribosomal protein S11
 gi|123738353|sp|Q2K9J3|RS11_RHIEC RecName: Full=30S ribosomal protein S11
 gi|226708406|sp|B3PWU4|RS11_RHIE6 RecName: Full=30S ribosomal protein S11
 gi|226708407|sp|B5ZZ56|RS11_RHILW RecName: Full=30S ribosomal protein S11
 gi|254765359|sp|B9JDV1|RS11_AGRRK RecName: Full=30S ribosomal protein S11
 gi|86281430|gb|ABC90493.1| 30S ribosomal protein S11 [Rhizobium etli CFN 42]
 gi|115256211|emb|CAK07292.1| putative 30S ribosomal protein S11 [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|190696657|gb|ACE90742.1| 30S ribosomal protein S11 [Rhizobium etli CIAT 652]
 gi|209534714|gb|ACI54649.1| ribosomal protein S11 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|221723146|gb|ACM26302.1| 30S ribosomal protein S11 [Agrobacterium radiobacter K84]
 gi|240858078|gb|ACS55745.1| ribosomal protein S11 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|327189693|gb|EGE56840.1| 30S ribosomal protein S11 [Rhizobium etli CNPAF512]
          Length = 129

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/116 (69%), Positives = 92/116 (79%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           KNI SG AHV STFNNT ITITD  GN IAWSS    GF GSRK++PFAAQ+A +DC+ K
Sbjct: 14  KNISSGVAHVNSTFNNTMITITDAQGNAIAWSSAGAKGFKGSRKSTPFAAQIAAEDCAKK 73

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           AQ HGM SLEV+V G G+GR+SALRAL+A GF I SI DVT I HNGCRPRK+RR+
Sbjct: 74  AQEHGMKSLEVEVCGPGSGRESALRALQAAGFMITSIRDVTPIPHNGCRPRKKRRV 129


>gi|329889150|ref|ZP_08267493.1| 30S ribosomal protein S11 [Brevundimonas diminuta ATCC 11568]
 gi|328844451|gb|EGF94015.1| 30S ribosomal protein S11 [Brevundimonas diminuta ATCC 11568]
          Length = 129

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 99/129 (76%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K P R++ RERKNI SG AHV ++FNNT +TITD  GN I+WSS   +GF GSRK++P
Sbjct: 1   MAKEPGRVKRRERKNITSGVAHVNASFNNTMVTITDAQGNAISWSSAGHMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KA  HG+ +LEV VSG G+GR+SALRAL+A+G TI +I DVT + HNG
Sbjct: 61  YAAQMAAEDAGKKAAEHGVKTLEVNVSGPGSGRESALRALQAVGMTITTIRDVTPMPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|91977629|ref|YP_570288.1| 30S ribosomal protein S11 [Rhodopseudomonas palustris BisB5]
 gi|123735293|sp|Q134V2|RS11_RHOPS RecName: Full=30S ribosomal protein S11
 gi|91684085|gb|ABE40387.1| SSU ribosomal protein S11P [Rhodopseudomonas palustris BisB5]
          Length = 129

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 94/116 (81%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           KNI SG AHV S+FNNT ITITD  GN IAWSS   +GF GSRK++P+AAQVA +D + K
Sbjct: 14  KNIASGIAHVNSSFNNTTITITDAQGNAIAWSSAGTMGFKGSRKSTPYAAQVAAEDVAKK 73

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           AQ HGM +LEV+V+G G+GR+SALRAL+A GFT+ SI DVT I HNGCRPRKRRR+
Sbjct: 74  AQEHGMRTLEVEVAGPGSGRESALRALQAAGFTVTSIRDVTTIPHNGCRPRKRRRV 129


>gi|260577156|ref|ZP_05845133.1| ribosomal protein S11 [Rhodobacter sp. SW2]
 gi|259020630|gb|EEW23949.1| ribosomal protein S11 [Rhodobacter sp. SW2]
          Length = 129

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  +RI+ +ERKNI +G AHV S+FNNT+I I+D  GN IAWSS   +GF GSRK++P
Sbjct: 1   MARDKTRIKRKERKNIAAGVAHVNSSFNNTKILISDVQGNAIAWSSSGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ HG+ +LEV+V G G+GR+SALRAL A+GF I SI DVT +AHNG
Sbjct: 61  YAAQMAAEDAGRKAQEHGVKTLEVEVQGPGSGRESALRALAAVGFNITSIRDVTPMAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|148260916|ref|YP_001235043.1| 30S ribosomal protein S11 [Acidiphilium cryptum JF-5]
 gi|326404314|ref|YP_004284396.1| 30S ribosomal protein S11 [Acidiphilium multivorum AIU301]
 gi|172047770|sp|A5FZU2|RS11_ACICJ RecName: Full=30S ribosomal protein S11
 gi|146402597|gb|ABQ31124.1| SSU ribosomal protein S11P [Acidiphilium cryptum JF-5]
 gi|325051176|dbj|BAJ81514.1| 30S ribosomal protein S11 [Acidiphilium multivorum AIU301]
          Length = 130

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 99/124 (79%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R R +ERKNI SG AHV+++FNNT +TI+D  GN I+WSS    GF GSRK++P+AAQV
Sbjct: 7   TRPRRKERKNISSGVAHVLASFNNTMVTISDAQGNAISWSSAGSQGFKGSRKSTPYAAQV 66

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +D   KA+ HGM +LE++VSG GAGR+SALRAL+ IGF+I +I D+T I HNGCRPRK
Sbjct: 67  AAEDAGRKAREHGMETLEIEVSGPGAGRESALRALQTIGFSITAIRDLTPIPHNGCRPRK 126

Query: 126 RRRI 129
           RRR+
Sbjct: 127 RRRV 130


>gi|163739472|ref|ZP_02146882.1| 30S ribosomal protein S13 [Phaeobacter gallaeciensis BS107]
 gi|163740265|ref|ZP_02147659.1| 30S ribosomal protein S11 [Phaeobacter gallaeciensis 2.10]
 gi|161386123|gb|EDQ10498.1| 30S ribosomal protein S11 [Phaeobacter gallaeciensis 2.10]
 gi|161387225|gb|EDQ11584.1| 30S ribosomal protein S13 [Phaeobacter gallaeciensis BS107]
          Length = 129

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 99/129 (76%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  +R + +ERKNI SG AHV S+FNNT+I I+D  GN I+WSS   +GF GSRK++P
Sbjct: 1   MARDKTRTKRKERKNIASGVAHVNSSFNNTKILISDVQGNAISWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ HG+ +LEV+V G G+GR+SALRAL A+GF I SI DVT IAHNG
Sbjct: 61  YAAQMAAEDAGKKAQEHGVKTLEVEVQGPGSGRESALRALAAVGFNITSIRDVTPIAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|84685392|ref|ZP_01013290.1| 30S ribosomal protein S11 [Maritimibacter alkaliphilus HTCC2654]
 gi|84666549|gb|EAQ13021.1| 30S ribosomal protein S11 [Rhodobacterales bacterium HTCC2654]
          Length = 129

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 99/129 (76%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  +R + +ERKNI +G AHV S+FNNT+I I+D  GN I+WSS   +GF GSRK++P
Sbjct: 1   MARDKTRTKRKERKNIAAGVAHVNSSFNNTKILISDVQGNAISWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +D   KAQ HG+ +LEV+V G G+GR+SALRAL A+GF I SI DVT IAHNG
Sbjct: 61  FAAQMAAEDAGKKAQEHGVKTLEVEVQGPGSGRESALRALAAVGFNITSIRDVTPIAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|56551436|ref|YP_162275.1| 30S ribosomal protein S11 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761083|ref|ZP_04759172.1| ribosomal protein S11 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260752951|ref|YP_003225844.1| 30S ribosomal protein S11 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|62287378|sp|Q5NQ41|RS11_ZYMMO RecName: Full=30S ribosomal protein S11
 gi|56543010|gb|AAV89164.1| ribosomal protein S11 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374702|gb|EER64163.1| ribosomal protein S11 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258552314|gb|ACV75260.1| ribosomal protein S11 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 129

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 99/129 (76%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M + P R++ RERKNI +G AHV ++FNNT ITITD  GN I+WSS  ++GF GSRK++P
Sbjct: 1   MAREPQRVKRRERKNISAGVAHVNASFNNTMITITDAQGNAISWSSAGMMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D   KA  HG+ +LEV+V G G+GR+SALRAL+A+GF I SI DVT I HNG
Sbjct: 61  YAAQVAAEDAGKKAAEHGVRTLEVEVKGPGSGRESALRALQAVGFHITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 121 VRPSKRRRV 129


>gi|159042864|ref|YP_001531658.1| 30S ribosomal protein S11 [Dinoroseobacter shibae DFL 12]
 gi|189040413|sp|A8LM80|RS11_DINSH RecName: Full=30S ribosomal protein S11
 gi|157910624|gb|ABV92057.1| 30S ribosomal protein S11 [Dinoroseobacter shibae DFL 12]
          Length = 129

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 77/129 (59%), Positives = 98/129 (75%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +   R + +ERKNI +G AHV S+FNNT+I I+D  GN IAWSS   +GF GSRK++P
Sbjct: 1   MARDKQRTKKKERKNIAAGVAHVNSSFNNTKILISDVQGNAIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ HG+ +LEV+V G G+GR+SALRAL A+GF I +I DVT IAHNG
Sbjct: 61  YAAQMAAEDAGKKAQEHGVKTLEVQVQGPGSGRESALRALAAVGFNITAIRDVTPIAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|119383535|ref|YP_914591.1| 30S ribosomal protein S11 [Paracoccus denitrificans PD1222]
 gi|152060802|sp|A1B051|RS11_PARDP RecName: Full=30S ribosomal protein S11
 gi|119373302|gb|ABL68895.1| SSU ribosomal protein S11P [Paracoccus denitrificans PD1222]
          Length = 129

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 77/129 (59%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  +RI+ +ERKNI +G AHV S+FNNT+I I+D  GN I+WSS   +GF GSRK++P
Sbjct: 1   MARDKTRIKRKERKNIATGVAHVNSSFNNTKILISDVQGNAISWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ HG+ +LEV+V G G+GR+SALRAL A+GF I +I DVT IAHNG
Sbjct: 61  YAAQMAAEDAGKKAQEHGVRTLEVEVQGPGSGRESALRALAAVGFNITAIRDVTPIAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|99080119|ref|YP_612273.1| 30S ribosomal protein S11 [Ruegeria sp. TM1040]
 gi|123379120|sp|Q1GK05|RS11_SILST RecName: Full=30S ribosomal protein S11
 gi|99036399|gb|ABF63011.1| SSU ribosomal protein S11P [Ruegeria sp. TM1040]
          Length = 129

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  +R + +ERKNI SG AHV S+FNNT+I I+D  GN I+WSS   +GF GSRK++P
Sbjct: 1   MARDKTRTKRKERKNIASGVAHVNSSFNNTKILISDVQGNAISWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ+HG+ +LEV+V G G+GR+SALRAL AIGF I +I DVT IAHNG
Sbjct: 61  YAAQMAAEDAGRKAQDHGVKTLEVEVQGPGSGRESALRALAAIGFNITNIRDVTPIAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|149184337|ref|ZP_01862655.1| 30S ribosomal protein S11 [Erythrobacter sp. SD-21]
 gi|148831657|gb|EDL50090.1| 30S ribosomal protein S11 [Erythrobacter sp. SD-21]
          Length = 129

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 98/129 (75%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M + P R+R R++KNI SG AH+ ++FNNT ITITD  GN I+WSS  ++GF GSRK++P
Sbjct: 1   MAREPGRVRRRDKKNISSGVAHINASFNNTMITITDAQGNAISWSSAGMMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA DD   KA  HG+ +LEV+V G G+GR+SALR L A+GFTI SI DVT I HNG
Sbjct: 61  YAAQVAADDAGRKAAEHGVRTLEVEVKGPGSGRESALRGLAAVGFTITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 121 VRPSKRRRV 129


>gi|254294417|ref|YP_003060440.1| ribosomal protein S11 [Hirschia baltica ATCC 49814]
 gi|254042948|gb|ACT59743.1| ribosomal protein S11 [Hirschia baltica ATCC 49814]
          Length = 129

 Score =  163 bits (412), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 98/129 (75%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  +R++   RKNI SG AHV S+FNNT ITITD  GN I+WSS   +GF GSRK++P
Sbjct: 1   MAREQTRVKRSARKNISSGVAHVNSSFNNTMITITDAQGNAISWSSAGHMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D   KAQ HG+ SLEV+V G G+GR+SALRAL++IG TI +I D+T I HNG
Sbjct: 61  YAAQVAAEDAGRKAQEHGLKSLEVQVRGPGSGRESALRALQSIGLTITTIHDITAIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|259416774|ref|ZP_05740694.1| 30S ribosomal protein S11 [Silicibacter sp. TrichCH4B]
 gi|259348213|gb|EEW59990.1| 30S ribosomal protein S11 [Silicibacter sp. TrichCH4B]
          Length = 129

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 77/129 (59%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  +R + +ERKNI +G AHV S+FNNT+I I+D  GN I+WSS   +GF GSRK++P
Sbjct: 1   MARDKTRTKRKERKNIATGVAHVNSSFNNTKILISDVQGNAISWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ+HG+ +LEV+V G G+GR+SALRAL AIGF I +I DVT IAHNG
Sbjct: 61  YAAQMAAEDAGRKAQDHGVKTLEVEVQGPGSGRESALRALAAIGFNITNIRDVTPIAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|56695424|ref|YP_165772.1| 30S ribosomal protein S11 [Ruegeria pomeroyi DSS-3]
 gi|62287368|sp|Q5LW33|RS11_SILPO RecName: Full=30S ribosomal protein S11
 gi|56677161|gb|AAV93827.1| ribosomal protein S11 [Ruegeria pomeroyi DSS-3]
          Length = 130

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 77/121 (63%), Positives = 96/121 (79%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + +ERKNI SG AHV STFNNT+I I+D  GN I+WSS   +GF GSRK++P+AAQ+A +
Sbjct: 10  KKKERKNIASGVAHVNSTFNNTKILISDVQGNAISWSSAGTMGFKGSRKSTPYAAQLAAE 69

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           D   KAQ+HG+ +LEV+V G G+GR+SALRAL A+GF I SI DVT IAHNGCRP KRRR
Sbjct: 70  DAGRKAQDHGVKTLEVEVQGPGSGRESALRALAAVGFNITSIRDVTPIAHNGCRPPKRRR 129

Query: 129 I 129
           +
Sbjct: 130 V 130


>gi|144900907|emb|CAM77771.1| 30S ribosomal protein S11 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 130

 Score =  162 bits (410), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 79/115 (68%), Positives = 92/115 (80%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI SG AHV STFNNT ITITD  GNTI+WSS  + GF GSRK++P+AAQVA +D   KA
Sbjct: 16  NITSGVAHVNSTFNNTMITITDAQGNTISWSSSGMQGFKGSRKSTPYAAQVAAEDAGRKA 75

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HGM +LEV+V G GAGR+SALRAL+A+GF+I SI DVT I HNGCRPRKRRR+
Sbjct: 76  MEHGMRTLEVEVKGPGAGRESALRALQAVGFSITSIRDVTPIPHNGCRPRKRRRV 130


>gi|90417744|ref|ZP_01225656.1| ribosomal protein S11 [Aurantimonas manganoxydans SI85-9A1]
 gi|90337416|gb|EAS51067.1| ribosomal protein S11 [Aurantimonas manganoxydans SI85-9A1]
          Length = 129

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K   R+R RERKNI SG AHV STFNNT ITITD  GN+IAWSS    GF GSRK++P
Sbjct: 1   MAKEAQRVRRRERKNITSGVAHVSSTFNNTLITITDAQGNSIAWSSAGAQGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +D + KAQ HGM +LEV+V G G+GR+SALRAL+A GFTI SI DVT I HNG
Sbjct: 61  FAAQVAAEDAAKKAQEHGMKTLEVEVRGPGSGRESALRALQAAGFTITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
            RPRK+RR+
Sbjct: 121 VRPRKKRRV 129


>gi|13470574|ref|NP_102143.1| 30S ribosomal protein S11 [Mesorhizobium loti MAFF303099]
 gi|260468531|ref|ZP_05813698.1| ribosomal protein S11 [Mesorhizobium opportunistum WSM2075]
 gi|319783343|ref|YP_004142819.1| 30S ribosomal protein S11 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|48474617|sp|Q98N34|RS11_RHILO RecName: Full=30S ribosomal protein S11
 gi|14021316|dbj|BAB47929.1| 30S ribosomal protein S11 [Mesorhizobium loti MAFF303099]
 gi|259028687|gb|EEW29996.1| ribosomal protein S11 [Mesorhizobium opportunistum WSM2075]
 gi|317169231|gb|ADV12769.1| 30S ribosomal protein S11 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 129

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 80/116 (68%), Positives = 92/116 (79%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           KNI SG AHV STFNNT ITITD  GN+IAWSS    GF GSRK++PFAAQ+A +D + K
Sbjct: 14  KNISSGVAHVNSTFNNTMITITDAQGNSIAWSSAGAQGFKGSRKSTPFAAQMAAEDVAKK 73

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           AQ HGM  LEV+V G G+GR+SALRAL+A GFTI SI DVT I HNGCRPRK+RR+
Sbjct: 74  AQEHGMRMLEVEVCGPGSGRESALRALQAAGFTITSIRDVTPIPHNGCRPRKKRRV 129


>gi|114771244|ref|ZP_01448664.1| 30S ribosomal protein S11 [alpha proteobacterium HTCC2255]
 gi|114548169|gb|EAU51056.1| 30S ribosomal protein S11 [alpha proteobacterium HTCC2255]
          Length = 128

 Score =  161 bits (407), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 74/124 (59%), Positives = 96/124 (77%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R++ +ERKNI +G AH+ S+FNNT+I I D  GN IAWSS   +GF GSRK++P+AAQ+
Sbjct: 5   ARMKRKERKNITAGVAHINSSFNNTKILIADAQGNAIAWSSAGTMGFKGSRKSTPYAAQM 64

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +D   KAQ HG+ +LEV+V G G+GR+SALRAL AIG  + SI DVT +AHNGCRP K
Sbjct: 65  AAEDAGKKAQEHGVKTLEVEVQGPGSGRESALRALAAIGLNVTSIRDVTPMAHNGCRPPK 124

Query: 126 RRRI 129
           RRR+
Sbjct: 125 RRRV 128


>gi|94496224|ref|ZP_01302802.1| 30S ribosomal protein S11 [Sphingomonas sp. SKA58]
 gi|294010566|ref|YP_003544026.1| ribosomal protein S11 [Sphingobium japonicum UT26S]
 gi|307294932|ref|ZP_07574774.1| 30S ribosomal protein S11 [Sphingobium chlorophenolicum L-1]
 gi|94424403|gb|EAT09426.1| 30S ribosomal protein S11 [Sphingomonas sp. SKA58]
 gi|292673896|dbj|BAI95414.1| ribosomal protein S11 [Sphingobium japonicum UT26S]
 gi|306879406|gb|EFN10624.1| 30S ribosomal protein S11 [Sphingobium chlorophenolicum L-1]
          Length = 129

 Score =  161 bits (407), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 77/129 (59%), Positives = 98/129 (75%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M + P RI+ RERKNI +G AHV ++FNNT +TITD  GN I+WSS  ++GF GSRK++P
Sbjct: 1   MAREPQRIKRRERKNISAGVAHVNASFNNTMVTITDAQGNAISWSSAGMMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQV  +D   KA  HG+ +LEV+V G G+GR+SALRAL+A+GF I SI DVT I HNG
Sbjct: 61  YAAQVCAEDAGRKAAEHGVRTLEVEVKGPGSGRESALRALQAVGFHITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 121 VRPSKRRRV 129


>gi|163760823|ref|ZP_02167902.1| putative 30S ribosomal protein S11 [Hoeflea phototrophica DFL-43]
 gi|162281867|gb|EDQ32159.1| putative 30S ribosomal protein S11 [Hoeflea phototrophica DFL-43]
          Length = 129

 Score =  160 bits (406), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 86/129 (66%), Positives = 102/129 (79%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R++ RERKNI SG AHV STFNNT ITITD  GN I+WSS    GF GSRK++P
Sbjct: 1   MAKEAARVKRRERKNISSGVAHVNSTFNNTMITITDAQGNAISWSSAGSKGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +D + KAQ+HGM SLEV+V G G+GR+SALRAL+A GFTI SI DVT I HNG
Sbjct: 61  FAAQMAAEDAAKKAQDHGMKSLEVEVCGPGSGRESALRALQAAGFTITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRK+RR+
Sbjct: 121 CRPRKKRRV 129


>gi|323136110|ref|ZP_08071193.1| 30S ribosomal protein S11 [Methylocystis sp. ATCC 49242]
 gi|322399201|gb|EFY01720.1| 30S ribosomal protein S11 [Methylocystis sp. ATCC 49242]
          Length = 129

 Score =  160 bits (406), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 85/129 (65%), Positives = 104/129 (80%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNIVSG AHV STFNNT ITITD  GNT++WSS   +GF GSRK++P
Sbjct: 1   MAKDTTRVRRRERKNIVSGVAHVNSTFNNTMITITDAQGNTVSWSSAGSMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D + KA  HG+ +LEV+VSG G+GR+SALRAL+A GFT+ SI DVT I HNG
Sbjct: 61  YAAQMAAEDAARKAGEHGVRTLEVEVSGPGSGRESALRALQAAGFTVTSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|83312208|ref|YP_422472.1| 30S ribosomal protein S11 [Magnetospirillum magneticum AMB-1]
 gi|123767953|sp|Q2W2L2|RS11_MAGMM RecName: Full=30S ribosomal protein S11
 gi|82947049|dbj|BAE51913.1| Ribosomal protein S11 [Magnetospirillum magneticum AMB-1]
          Length = 131

 Score =  160 bits (405), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 78/115 (67%), Positives = 91/115 (79%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI SG AHV +TFNNT ITITD  GNTI+WSS  + GF GSRK++P+AAQVA +D   KA
Sbjct: 17  NITSGVAHVNATFNNTMITITDAQGNTISWSSAGMQGFKGSRKSTPYAAQVAAEDAGRKA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HGM +LEV+V G GAGR+SALRAL+A+GF I SI DVT I HNGCRPRKRRR+
Sbjct: 77  SEHGMRTLEVEVKGPGAGRESALRALQAVGFQITSIRDVTPIPHNGCRPRKRRRV 131


>gi|149915868|ref|ZP_01904392.1| 30S ribosomal protein S13 [Roseobacter sp. AzwK-3b]
 gi|149810191|gb|EDM70037.1| 30S ribosomal protein S13 [Roseobacter sp. AzwK-3b]
          Length = 129

 Score =  160 bits (404), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 77/129 (59%), Positives = 96/129 (74%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +   R + +  KNI +G AHV S+FNNT+I I+D  GN IAWSS   +GF GSRK++P
Sbjct: 1   MARDTRRTKKKVSKNIATGVAHVNSSFNNTKILISDVQGNAIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ HGM +LEV+V G G+GR+SALRAL A+GF I SI DVT IAHNG
Sbjct: 61  YAAQMAAEDAGRKAQEHGMKTLEVEVQGPGSGRESALRALAAVGFNITSIRDVTPIAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|117924178|ref|YP_864795.1| 30S ribosomal protein S11 [Magnetococcus sp. MC-1]
 gi|152060788|sp|A0L5Z6|RS11_MAGSM RecName: Full=30S ribosomal protein S11
 gi|117607934|gb|ABK43389.1| SSU ribosomal protein S11P [Magnetococcus sp. MC-1]
          Length = 131

 Score =  159 bits (403), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 95/124 (76%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R + +ERKNI SG AH+ STFNNT ITITD HGN+I+W S    GF GSRK++PFAAQ+
Sbjct: 8   ARTKKKERKNIASGIAHIHSTFNNTLITITDTHGNSISWGSAGAQGFKGSRKSTPFAAQM 67

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A ++   KA +HGM +LEV++ G G+GR+SALRAL AIGF I  + DVT I HNGCRP K
Sbjct: 68  AAENAGKKAMDHGMRNLEVRLKGPGSGRESALRALAAIGFNISHVQDVTPIPHNGCRPPK 127

Query: 126 RRRI 129
           RRR+
Sbjct: 128 RRRV 131


>gi|83949764|ref|ZP_00958497.1| 30S ribosomal protein S11 [Roseovarius nubinhibens ISM]
 gi|83837663|gb|EAP76959.1| 30S ribosomal protein S11 [Roseovarius nubinhibens ISM]
          Length = 129

 Score =  159 bits (401), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 77/129 (59%), Positives = 96/129 (74%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +   R + +  KNI +G AHV S+FNNT+I I+D  GN IAWSS   +GF GSRK++P
Sbjct: 1   MARDTRRGKRKVSKNIATGVAHVNSSFNNTKILISDVQGNAIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ HGM +LEV+V G G+GR+SALRAL A+GF I SI DVT IAHNG
Sbjct: 61  YAAQMAAEDAGKKAQEHGMKTLEVEVQGPGSGRESALRALAAVGFNITSIRDVTPIAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|85706696|ref|ZP_01037788.1| 30S ribosomal protein S11 [Roseovarius sp. 217]
 gi|85668754|gb|EAQ23623.1| 30S ribosomal protein S11 [Roseovarius sp. 217]
          Length = 129

 Score =  159 bits (401), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 76/129 (58%), Positives = 96/129 (74%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +   R + +  KNI +G AHV S+FNNT+I I+D  GN IAWSS   +GF GSRK++P
Sbjct: 1   MARDTKRTKKKVSKNIATGVAHVNSSFNNTKILISDVQGNAIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ HGM SL+V+V G G+GR+SALRAL A+GF I SI DVT +AHNG
Sbjct: 61  YAAQMAAEDAGKKAQEHGMRSLDVEVQGPGSGRESALRALAAVGFNITSIRDVTPMAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|126724891|ref|ZP_01740734.1| 30S ribosomal protein S11 [Rhodobacterales bacterium HTCC2150]
 gi|126706055|gb|EBA05145.1| 30S ribosomal protein S11 [Rhodobacterales bacterium HTCC2150]
          Length = 129

 Score =  159 bits (401), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 96/129 (74%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +   R + +ERKNI +G AH+ S+FNNT+I I+D  GN I+WSS    GF GSRK++P
Sbjct: 1   MARDKVRAKKKERKNIAAGVAHINSSFNNTKILISDVQGNAISWSSSGTCGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ HG+ +LEV+V G G+GR+SALRAL AIG  + SI DVT IAHNG
Sbjct: 61  YAAQMAAEDAGKKAQEHGVKTLEVEVQGPGSGRESALRALAAIGLNVTSIRDVTPIAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|328543381|ref|YP_004303490.1| 30S ribosomal protein S11 [Polymorphum gilvum SL003B-26A1]
 gi|326413126|gb|ADZ70189.1| 30S ribosomal protein S11 [Polymorphum gilvum SL003B-26A1]
          Length = 129

 Score =  159 bits (401), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 86/129 (66%), Positives = 101/129 (78%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNI SG AHV STFNNT ITITD  GNTI+WSS   +GF GSRK++P
Sbjct: 1   MAKDTTRVRRRERKNISSGVAHVNSTFNNTMITITDAQGNTISWSSAGALGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D + KA  HGM +LEV+V G G+GR+SALRAL+A GF I SI DVT I HNG
Sbjct: 61  YAAQVAAEDAARKATEHGMRTLEVEVRGPGSGRESALRALQAAGFLITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|296282606|ref|ZP_06860604.1| 30S ribosomal protein S11 [Citromicrobium bathyomarinum JL354]
          Length = 129

 Score =  158 bits (400), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M + P RIR RERKNI SG AHV ++FNNT ITITD  GN I+WSS  ++GF GSRK++P
Sbjct: 1   MAREPGRIRRRERKNISSGVAHVNASFNNTMITITDAQGNAISWSSAGMMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA DD   KA  HG+ +LEV+V G G+GR+SALRAL+A+GFTI SI DVT I HNG
Sbjct: 61  YAAQVAADDAGKKAAEHGVRTLEVEVKGPGSGRESALRALQAVGFTITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 121 VRPSKRRRV 129


>gi|149202867|ref|ZP_01879838.1| 30S ribosomal protein S11 [Roseovarius sp. TM1035]
 gi|149143413|gb|EDM31449.1| 30S ribosomal protein S11 [Roseovarius sp. TM1035]
          Length = 129

 Score =  158 bits (399), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 76/129 (58%), Positives = 96/129 (74%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +   R + +  KNI +G AHV S+FNNT+I I+D  GN IAWSS   +GF GSRK++P
Sbjct: 1   MARDTKRTKKKVSKNIATGVAHVNSSFNNTKILISDVQGNAIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ HGM SL+V+V G G+GR+SALRAL A+GF I SI DVT +AHNG
Sbjct: 61  YAAQMAAEDAGRKAQEHGMRSLDVEVQGPGSGRESALRALAAVGFNITSIRDVTPMAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|84499817|ref|ZP_00998105.1| 30S ribosomal protein S11 [Oceanicola batsensis HTCC2597]
 gi|84392961|gb|EAQ05172.1| 30S ribosomal protein S11 [Oceanicola batsensis HTCC2597]
          Length = 129

 Score =  158 bits (399), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 97/129 (75%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +   R++ +  KNI +G AHV S+FNNT+I I+D  GN I+WSS   +GF GSRK++P
Sbjct: 1   MARDTRRVKKKVSKNIAAGVAHVNSSFNNTKILISDVQGNAISWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ HG+ +LEV+V G G+GR+SALRAL A+GF I SI DVT IAHNG
Sbjct: 61  YAAQMAAEDAGRKAQEHGVKTLEVEVQGPGSGRESALRALAAVGFNITSIRDVTPIAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|163733784|ref|ZP_02141226.1| 30S ribosomal protein S11 [Roseobacter litoralis Och 149]
 gi|161392895|gb|EDQ17222.1| 30S ribosomal protein S11 [Roseobacter litoralis Och 149]
          Length = 129

 Score =  157 bits (398), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 96/129 (74%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +   R++ +  KNI +G AHV S+FNNT+I I+D  GN IAWSS   +GF GSRK++P
Sbjct: 1   MARDKVRVKKKASKNIAAGVAHVNSSFNNTKILISDVQGNAIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ HG+ +LEV+V G G+GR+SALRAL A GF I SI DVT +AHNG
Sbjct: 61  YAAQMAAEDAGRKAQEHGVKTLEVEVQGPGSGRESALRALAAAGFNITSIRDVTPMAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|326387080|ref|ZP_08208690.1| 30S ribosomal protein S11 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208261|gb|EGD59068.1| 30S ribosomal protein S11 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 129

 Score =  157 bits (398), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 81/129 (62%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M + P RI+ RERKNI SG AHV ++FNNT ITITD  GN I+WSS  ++GF GSRK++P
Sbjct: 1   MAREPQRIKRRERKNITSGVAHVNASFNNTMITITDAQGNAISWSSAGMMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA DD   KA  HG+ +LEV+V G G+GR+SALRAL+A+GFTI +I DVT I HNG
Sbjct: 61  YAAQVAADDAGKKAAEHGVRTLEVEVKGPGSGRESALRALQAVGFTITAIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 121 VRPSKRRRV 129


>gi|126736629|ref|ZP_01752369.1| ribosomal protein S11 [Roseobacter sp. CCS2]
 gi|255261210|ref|ZP_05340552.1| 30S ribosomal protein S11 [Thalassiobium sp. R2A62]
 gi|126713942|gb|EBA10813.1| ribosomal protein S11 [Roseobacter sp. CCS2]
 gi|255103545|gb|EET46219.1| 30S ribosomal protein S11 [Thalassiobium sp. R2A62]
          Length = 129

 Score =  157 bits (397), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 97/129 (75%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +   R + +  KNI +G AHV S+FNNT+I I+D  GN I+WSS   +GF GSRK++P
Sbjct: 1   MARDTKRTKKKVSKNIAAGVAHVNSSFNNTKILISDVQGNAISWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ+HG+ +LEV+V G G+GR+SALRAL A+GF I SI DVT +AHNG
Sbjct: 61  YAAQMAAEDAGKKAQDHGVKTLEVEVQGPGSGRESALRALAAVGFNITSIRDVTPMAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|84515659|ref|ZP_01003020.1| 30S ribosomal protein S11 [Loktanella vestfoldensis SKA53]
 gi|84510101|gb|EAQ06557.1| 30S ribosomal protein S11 [Loktanella vestfoldensis SKA53]
          Length = 129

 Score =  157 bits (396), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 96/129 (74%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +   R + +  KNI +G AHV S+FNNT+I I+D  GN IAWSS   +GF GSRK++P
Sbjct: 1   MARDTKRTKKKVSKNIAAGVAHVNSSFNNTKILISDVQGNAIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ+HG+ +LEV+V G G+GR+SALRAL A GF I SI DVT +AHNG
Sbjct: 61  YAAQMAAEDAGKKAQDHGVKTLEVEVQGPGSGRESALRALAAAGFNITSIRDVTPMAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|87200541|ref|YP_497798.1| 30S ribosomal protein S11 [Novosphingobium aromaticivorans DSM
           12444]
 gi|123763417|sp|Q2G5A9|RS11_NOVAD RecName: Full=30S ribosomal protein S11
 gi|87136222|gb|ABD26964.1| SSU ribosomal protein S11P [Novosphingobium aromaticivorans DSM
           12444]
          Length = 129

 Score =  156 bits (395), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M + P RI+ RERKNI SG AHV ++FNNT +TITD  GN I+WSS  ++GF GSRK++P
Sbjct: 1   MAREPQRIKRRERKNITSGIAHVNASFNNTMVTITDAQGNAISWSSAGMMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA DD   KA  HG+ +LEV+V G G+GR+SALRAL+A+GFTI +I DVT I HNG
Sbjct: 61  YAAQVAADDAGKKAAEHGVRTLEVEVKGPGSGRESALRALQAVGFTITAIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 121 VRPSKRRRV 129


>gi|254486715|ref|ZP_05099920.1| ribosomal protein S11 [Roseobacter sp. GAI101]
 gi|214043584|gb|EEB84222.1| ribosomal protein S11 [Roseobacter sp. GAI101]
          Length = 129

 Score =  156 bits (394), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 97/129 (75%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  ++ + +  KNI +G AHV S+FNNT+I I+D  GN IAWSS   +GF GSRK++P
Sbjct: 1   MAREKTKTKRKVSKNIAAGVAHVNSSFNNTKILISDVQGNAIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ+HG+ +LEV+V G G+GR+SALRAL A GF I SI DVT +AHNG
Sbjct: 61  YAAQMAAEDVGKKAQDHGVKTLEVEVQGPGSGRESALRALAAAGFNITSIRDVTPMAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|126728200|ref|ZP_01744016.1| 30S ribosomal protein S11 [Sagittula stellata E-37]
 gi|126711165|gb|EBA10215.1| 30S ribosomal protein S11 [Sagittula stellata E-37]
          Length = 131

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 74/116 (63%), Positives = 91/116 (78%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           KNI +G AHV STFNNT+I I+D  GN I+WSS   +GF GSRK++P+AAQ+A +D   K
Sbjct: 16  KNIAAGVAHVNSTFNNTKILISDVQGNAISWSSAGTMGFKGSRKSTPYAAQLAAEDAGKK 75

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           AQ HG+ +LEV+V G G+GR+SALRAL A+GF I SI DVT IAHNGCRP KRRR+
Sbjct: 76  AQEHGVKTLEVEVQGPGSGRESALRALAAVGFNITSIRDVTPIAHNGCRPPKRRRV 131


>gi|110678753|ref|YP_681760.1| 30S ribosomal protein S11 [Roseobacter denitrificans OCh 114]
 gi|123172727|sp|Q16AB9|RS11_ROSDO RecName: Full=30S ribosomal protein S11
 gi|109454869|gb|ABG31074.1| ribosomal protein S11 [Roseobacter denitrificans OCh 114]
          Length = 129

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 96/129 (74%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +   R++ +  KNI +G AHV S+FNNT+I I+D  GN I+WSS   +GF GSRK++P
Sbjct: 1   MARDKVRVKKKASKNIAAGVAHVNSSFNNTKILISDVQGNAISWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ HG+ +LEV+V G G+GR+SALRAL A GF I SI DVT +AHNG
Sbjct: 61  YAAQMAAEDAGRKAQEHGVKTLEVEVQGPGSGRESALRALAAAGFNITSIRDVTPMAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|310816987|ref|YP_003964951.1| 30S ribosomal protein S11 [Ketogulonicigenium vulgare Y25]
 gi|308755722|gb|ADO43651.1| 30S ribosomal protein S11 [Ketogulonicigenium vulgare Y25]
          Length = 130

 Score =  155 bits (393), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 75/116 (64%), Positives = 91/116 (78%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           KNI +G AHV S+FNNT+I I+D  GN IAWSS   +GF GSRK++P+AAQ+A +D   K
Sbjct: 15  KNIAAGVAHVNSSFNNTKILISDVQGNAIAWSSSGTMGFKGSRKSTPYAAQMAAEDAGRK 74

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           AQ HG+ +LEV+V G G+GR+SALRAL AIGF I SI DVT IAHNGCRP KRRR+
Sbjct: 75  AQEHGVKTLEVEVQGPGSGRESALRALAAIGFNITSIRDVTPIAHNGCRPPKRRRV 130


>gi|163745567|ref|ZP_02152927.1| 30S ribosomal protein S11 [Oceanibulbus indolifex HEL-45]
 gi|161382385|gb|EDQ06794.1| 30S ribosomal protein S11 [Oceanibulbus indolifex HEL-45]
          Length = 129

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 97/129 (75%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  ++ + +  KNI +G AHV S+FNNT+I I+D  GN IAWSS   +GF GSRK++P
Sbjct: 1   MARDKTKTKRKVSKNIAAGVAHVNSSFNNTKILISDVQGNAIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ+HG+ +LEV+V G G+GR+SALRAL A GF I SI DVT +AHNG
Sbjct: 61  YAAQMAAEDAGRKAQDHGVKTLEVEVQGPGSGRESALRALAAAGFNITSIRDVTPMAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|83854949|ref|ZP_00948479.1| 30S ribosomal protein S11 [Sulfitobacter sp. NAS-14.1]
 gi|83941472|ref|ZP_00953934.1| 30S ribosomal protein S11 [Sulfitobacter sp. EE-36]
 gi|83842792|gb|EAP81959.1| 30S ribosomal protein S11 [Sulfitobacter sp. NAS-14.1]
 gi|83847292|gb|EAP85167.1| 30S ribosomal protein S11 [Sulfitobacter sp. EE-36]
          Length = 129

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 73/129 (56%), Positives = 97/129 (75%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  ++ + +  KNI +G AHV S+FNNT+I I+D  GN I+WSS   +GF GSRK++P
Sbjct: 1   MAREKTKTKRKVSKNIAAGVAHVNSSFNNTKILISDVQGNAISWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KAQ+HG+ +LEV+V G G+GR+SALRAL A GF I SI DVT +AHNG
Sbjct: 61  YAAQMAAEDAGKKAQDHGVKTLEVEVQGPGSGRESALRALAAAGFNITSIRDVTPMAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|118579143|ref|YP_900393.1| 30S ribosomal protein S11 [Pelobacter propionicus DSM 2379]
 gi|152060803|sp|A1ALW5|RS11_PELPD RecName: Full=30S ribosomal protein S11
 gi|118501853|gb|ABK98335.1| SSU ribosomal protein S11P [Pelobacter propionicus DSM 2379]
          Length = 131

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 92/121 (76%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + RERKN+ +G AH+ +TFNNT ITI D  GN +AWS+    GF GSRK++PFAAQVA +
Sbjct: 11  KKRERKNVTNGVAHIHATFNNTMITIADTAGNVLAWSTSGAKGFKGSRKSTPFAAQVAAE 70

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           DC+ KAQ HG+ ++EV V G G+GR+SALRAL+A GF I  I DVT I HNGCRP K+RR
Sbjct: 71  DCAKKAQEHGLRNVEVYVKGPGSGRESALRALQAAGFNISFIKDVTPIPHNGCRPPKKRR 130

Query: 129 I 129
           +
Sbjct: 131 V 131


>gi|89053107|ref|YP_508558.1| 30S ribosomal protein S11 [Jannaschia sp. CCS1]
 gi|123287000|sp|Q28US9|RS11_JANSC RecName: Full=30S ribosomal protein S11
 gi|88862656|gb|ABD53533.1| SSU ribosomal protein S11P [Jannaschia sp. CCS1]
          Length = 129

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 74/116 (63%), Positives = 92/116 (79%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           KNI +G AHV S+FNNT+I I+D  GN IAWSS   +GF GSRK++PFAAQ+A +D   K
Sbjct: 14  KNIAAGVAHVNSSFNNTKILISDVQGNAIAWSSAGTMGFKGSRKSTPFAAQMAAEDAGKK 73

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           AQ+HG+ +LEV+V G G+GR+SALRAL A+GF I SI DVT +AHNGCRP KRRR+
Sbjct: 74  AQDHGVRTLEVEVQGPGSGRESALRALAALGFQISSIRDVTPMAHNGCRPPKRRRV 129


>gi|239787586|emb|CAX84054.1| 30S ribosomal protein S11 [uncultured bacterium]
          Length = 133

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 94/127 (74%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K+ +RI+ +ERKNI SG AH+ STFNNT ++ITD  GN I+W S    GF GSRK++PFA
Sbjct: 7   KTATRIKKKERKNIASGIAHIRSTFNNTIVSITDTVGNVISWGSAGAQGFKGSRKSTPFA 66

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +D   KA  HGM +LEV++ G G+GR+SALRAL  IGF I  + DVT I HNGCR
Sbjct: 67  AQMAAEDAGRKAMEHGMRNLEVRLKGPGSGRESALRALANIGFNIAFVQDVTPIPHNGCR 126

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 127 PPKRRRV 133


>gi|254501716|ref|ZP_05113867.1| ribosomal protein S11 [Labrenzia alexandrii DFL-11]
 gi|222437787|gb|EEE44466.1| ribosomal protein S11 [Labrenzia alexandrii DFL-11]
          Length = 129

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 86/129 (66%), Positives = 101/129 (78%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNI SG AHV STFNNT ITITD  GNTI+WSS   +GF GSRK++P
Sbjct: 1   MAKDTTRVRRRERKNISSGVAHVNSTFNNTMITITDAQGNTISWSSAGALGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D + KA  HGM +LEV+V G G+GR+SALRAL+A GF I SI DVT I HNG
Sbjct: 61  YAAQVAAEDAAKKAAEHGMRTLEVEVRGPGSGRESALRALQAAGFLITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|158424155|ref|YP_001525447.1| 30S ribosomal protein S11 [Azorhizobium caulinodans ORS 571]
 gi|172047975|sp|A8IAN8|RS11_AZOC5 RecName: Full=30S ribosomal protein S11
 gi|158331044|dbj|BAF88529.1| ribosomal protein S11 [Azorhizobium caulinodans ORS 571]
          Length = 129

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 82/129 (63%), Positives = 102/129 (79%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R++ RERKNI SG AHV ++FNNT ITITD  GNTI+WSS   +GF GSRK++P
Sbjct: 1   MAKEAARVKRRERKNIASGVAHVNASFNNTMITITDAQGNTISWSSAGAMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D + KA  HGM +LEV+VSG G+GR+SALRAL+A GF + SI DVT I HNG
Sbjct: 61  YAAQLAAEDAARKAAEHGMRTLEVEVSGPGSGRESALRALQAAGFLVTSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|154248692|ref|YP_001419650.1| ribosomal protein S11 [Xanthobacter autotrophicus Py2]
 gi|226708436|sp|A7IPP7|RS11_XANP2 RecName: Full=30S ribosomal protein S11
 gi|154162777|gb|ABS69993.1| ribosomal protein S11 [Xanthobacter autotrophicus Py2]
          Length = 129

 Score =  154 bits (389), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 102/129 (79%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R++ RERKNI SG AHV ++FNNT ITITD  GNTI+WSS   +GF GSRK++P
Sbjct: 1   MAKEATRVKRRERKNIASGVAHVNASFNNTMITITDAQGNTISWSSAGAMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D + KA  HGM +LEV+VSG G+GR+SALRAL+A GF + SI DVT I HNG
Sbjct: 61  YAAQVAAEDAARKAAEHGMRTLEVEVSGPGSGRESALRALQAAGFLVTSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|222056681|ref|YP_002539043.1| ribosomal protein S11 [Geobacter sp. FRC-32]
 gi|221565970|gb|ACM21942.1| ribosomal protein S11 [Geobacter sp. FRC-32]
          Length = 131

 Score =  154 bits (389), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 90/115 (78%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI +G AH+ +TFNNT ITITDP GN +AWS+    GF GSRK++PFAAQ+A +DC+ KA
Sbjct: 17  NIPNGVAHIQATFNNTMITITDPVGNVVAWSTSGCKGFKGSRKSTPFAAQIAAEDCAKKA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           Q HGM S+EV V G G+GR+SALRAL+A GF+I  I DVT I HNGCRP KRRR+
Sbjct: 77  QEHGMRSVEVYVKGPGSGRESALRALQAAGFSISFIRDVTPIPHNGCRPPKRRRV 131


>gi|330993872|ref|ZP_08317804.1| 30S ribosomal protein S11 [Gluconacetobacter sp. SXCC-1]
 gi|329759140|gb|EGG75652.1| 30S ribosomal protein S11 [Gluconacetobacter sp. SXCC-1]
          Length = 110

 Score =  153 bits (387), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 89/109 (81%)

Query: 21  AHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMS 80
           AHV+STFNNT ITI+D  GN IAWSS    GF GSRK++P+AAQVA +D   KA+ HGM 
Sbjct: 2   AHVLSTFNNTMITISDAQGNAIAWSSAGAQGFKGSRKSTPYAAQVAAEDAGRKAREHGME 61

Query: 81  SLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +LE++VSG G+GR+SALRAL+A+GF+I +I D+T + HNGCRPRKRRR+
Sbjct: 62  TLEIEVSGPGSGRESALRALQAVGFSITAIRDMTPVPHNGCRPRKRRRV 110


>gi|89070529|ref|ZP_01157818.1| 30S ribosomal protein S11 [Oceanicola granulosus HTCC2516]
 gi|89043836|gb|EAR50034.1| 30S ribosomal protein S11 [Oceanicola granulosus HTCC2516]
          Length = 131

 Score =  153 bits (386), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 73/116 (62%), Positives = 90/116 (77%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           KNI +G AHV S+FNNT+I I+D  GN I+WSS   +GF GSRK++P+AAQ+A +D   K
Sbjct: 16  KNIAAGVAHVNSSFNNTKILISDVQGNAISWSSAGTMGFKGSRKSTPYAAQMAAEDAGKK 75

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           AQ HG+ +LEV+V G G+GR+SALRAL A GF I SI DVT IAHNGCRP KRRR+
Sbjct: 76  AQEHGVKTLEVEVQGPGSGRESALRALAAAGFNITSIRDVTPIAHNGCRPPKRRRV 131


>gi|86135792|ref|ZP_01054371.1| 30S ribosomal protein S11 [Roseobacter sp. MED193]
 gi|85826666|gb|EAQ46862.1| 30S ribosomal protein S11 [Roseobacter sp. MED193]
          Length = 129

 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 90/115 (78%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI +G AHV S+FNNT+I I+D  GN IAWSS   +GF GSRK++P+AAQ+A +D   KA
Sbjct: 15  NIATGVAHVNSSFNNTKILISDVQGNAIAWSSAGSMGFKGSRKSTPYAAQMAAEDAGKKA 74

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           Q+HG+ +LEV+V G G GR+SALRAL AIGF I SI DVT +AHNGCRP KRRR+
Sbjct: 75  QDHGVKTLEVEVQGPGGGRESALRALAAIGFNITSIRDVTPMAHNGCRPPKRRRV 129


>gi|307946310|ref|ZP_07661645.1| 30S ribosomal protein S11 [Roseibium sp. TrichSKD4]
 gi|307769974|gb|EFO29200.1| 30S ribosomal protein S11 [Roseibium sp. TrichSKD4]
          Length = 129

 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 85/129 (65%), Positives = 101/129 (78%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNI SG AHV STFNNT ITITD  GN I+WSS   +GF GSRK++P
Sbjct: 1   MAKDTTRVRRRERKNISSGVAHVNSTFNNTMITITDAQGNAISWSSAGALGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D + KA +HGM +LEV+V G G+GR+SALRAL+A GF I SI DVT I HNG
Sbjct: 61  YAAQVAAEDAAKKAADHGMRTLEVEVRGPGSGRESALRALQAAGFLITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|118591157|ref|ZP_01548556.1| 30S ribosomal protein S11 [Stappia aggregata IAM 12614]
 gi|118436233|gb|EAV42875.1| 30S ribosomal protein S11 [Stappia aggregata IAM 12614]
          Length = 129

 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 85/129 (65%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R RERKNI SG AHV STFNNT ITITD  GN I+WSS   +GF GSRK++P
Sbjct: 1   MAKDTTRVRRRERKNISSGVAHVNSTFNNTMITITDAQGNAISWSSAGALGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA +D + KA  HGM +LEV+V G G+GR+SALRAL+A GF I SI DVT I HNG
Sbjct: 61  YAAQVAAEDAAKKAAEHGMRTLEVEVRGPGSGRESALRALQAAGFLITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|78221871|ref|YP_383618.1| 30S ribosomal protein S11 [Geobacter metallireducens GS-15]
 gi|91207783|sp|Q39XY1|RS11_GEOMG RecName: Full=30S ribosomal protein S11
 gi|78193126|gb|ABB30893.1| SSU ribosomal protein S11P [Geobacter metallireducens GS-15]
          Length = 131

 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 90/115 (78%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI +G AH+ +TFNNT ITITDP GN +AWSS    GF GSRK++PFAAQVA +DC+ KA
Sbjct: 17  NIPNGVAHIQATFNNTIITITDPAGNVVAWSSAGGKGFKGSRKSTPFAAQVAAEDCAKKA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           Q+HGM S+EV V G G+GR+SALRAL+A GF +  I DVT I HNGCRP KRRR+
Sbjct: 77  QDHGMRSVEVYVKGPGSGRESALRALQAAGFHVNFIRDVTPIPHNGCRPPKRRRV 131


>gi|254460747|ref|ZP_05074163.1| ribosomal protein S11 [Rhodobacterales bacterium HTCC2083]
 gi|206677336|gb|EDZ41823.1| ribosomal protein S11 [Rhodobacteraceae bacterium HTCC2083]
          Length = 129

 Score =  152 bits (384), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 73/129 (56%), Positives = 94/129 (72%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +   R + +  KNI +G AHV S+FNNT+I I+D  GN I+WSS   +GF GSRK++P
Sbjct: 1   MAREAKRTKKKVSKNIAAGVAHVNSSFNNTKILISDVQGNAISWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D   KA  HG+ +LEV+V G G+GR+SALRAL A GF I SI DVT +AHNG
Sbjct: 61  YAAQMAAEDAGRKAAEHGVKTLEVEVQGPGSGRESALRALAAAGFNITSIRDVTPMAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|114767225|ref|ZP_01446090.1| 30S ribosomal protein S11 [Pelagibaca bermudensis HTCC2601]
 gi|114540635|gb|EAU43706.1| 30S ribosomal protein S11 [Roseovarius sp. HTCC2601]
          Length = 130

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 90/116 (77%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           KNI +G AHV S+FNNT+I I+D  GN I+WSS   +GF GSRK++P+AAQ+A +D   K
Sbjct: 15  KNIAAGVAHVNSSFNNTKILISDVQGNAISWSSAGTMGFKGSRKSTPYAAQLAAEDAGKK 74

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           AQ HG+ +LEV+V G G+GR+SALRAL A GF I SI DV+ IAHNGCRP KRRR+
Sbjct: 75  AQEHGVKTLEVEVQGPGSGRESALRALAAAGFNITSIRDVSPIAHNGCRPPKRRRV 130


>gi|148263163|ref|YP_001229869.1| 30S ribosomal protein S11 [Geobacter uraniireducens Rf4]
 gi|146396663|gb|ABQ25296.1| SSU ribosomal protein S11P [Geobacter uraniireducens Rf4]
          Length = 131

 Score =  151 bits (381), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 89/115 (77%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI +G AH+ +TFNNT ITITDP GN IAW +    GF GSRK++PFAAQ+A +DC+ KA
Sbjct: 17  NIPNGVAHIQATFNNTMITITDPVGNVIAWCTSGCKGFKGSRKSTPFAAQMAAEDCAKKA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           Q HGM S+EV V G G+GR+SALRAL+A GF+I  I DVT I HNGCRP KRRR+
Sbjct: 77  QEHGMRSVEVFVKGPGSGRESALRALQAAGFSISFIRDVTPIPHNGCRPPKRRRV 131


>gi|85709030|ref|ZP_01040096.1| 30S ribosomal protein S11 [Erythrobacter sp. NAP1]
 gi|85690564|gb|EAQ30567.1| 30S ribosomal protein S11 [Erythrobacter sp. NAP1]
          Length = 129

 Score =  150 bits (379), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 77/129 (59%), Positives = 97/129 (75%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M + P ++R R+RKNI SG AH+ ++FNNT ITITD  GN I+WSS  ++GF GSRK++P
Sbjct: 1   MAREPGKVRRRDRKNITSGVAHINASFNNTMITITDAQGNAISWSSAGMMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQVA DD   KA  HG+ +LEV+V G G+GR+SALR L A+GF I SI DVT I HNG
Sbjct: 61  YAAQVAADDAGKKAAEHGVRTLEVEVKGPGSGRESALRGLAAVGFNITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 121 VRPSKRRRV 129


>gi|296534010|ref|ZP_06896526.1| 30S ribosomal protein S11 [Roseomonas cervicalis ATCC 49957]
 gi|296265676|gb|EFH11785.1| 30S ribosomal protein S11 [Roseomonas cervicalis ATCC 49957]
          Length = 110

 Score =  150 bits (378), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (79%)

Query: 21  AHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMS 80
           AHV+++FNNT +TITD  GN IAWSS    GF GSRK++P+AAQVA +D   KA+ HGM 
Sbjct: 2   AHVLASFNNTIVTITDSQGNAIAWSSAGSQGFKGSRKSTPYAAQVAAEDAGRKAREHGME 61

Query: 81  SLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +LE+ VSG G+GR+SALRAL+A+GF + +I DVT I HNGCRPRKRRR+
Sbjct: 62  TLEIMVSGPGSGRESALRALQAVGFYVTAIKDVTPIPHNGCRPRKRRRV 110


>gi|121602190|ref|YP_989020.1| 30S ribosomal protein S11 [Bartonella bacilliformis KC583]
 gi|152060576|sp|A1USR7|RS11_BARBK RecName: Full=30S ribosomal protein S11
 gi|120614367|gb|ABM44968.1| ribosomal protein S11 [Bartonella bacilliformis KC583]
          Length = 129

 Score =  149 bits (377), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 97/129 (75%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K   R+R  ERKNI S   H+ STFNNT ITITD  G+TIAWSS    GF GSRK++P
Sbjct: 1   MAKEAKRVRRSERKNISSSVVHINSTFNNTMITITDSQGDTIAWSSAGAQGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA  DC+ KA+ HG+ SLEV+V G G+GR+SALRAL++ GF I SI DVT I HNG
Sbjct: 61  FAAQVAAADCAKKAEEHGVRSLEVEVCGPGSGRESALRALQSAGFIITSIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|310659476|ref|YP_003937197.1| 30S ribosomal protein S11 [Clostridium sticklandii DSM 519]
 gi|308826254|emb|CBH22292.1| 30S ribosomal subunit protein S11 [Clostridium sticklandii]
          Length = 132

 Score =  149 bits (375), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 93/127 (73%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K  +R++ RERKNI  G AH+ STFNNT IT+TD HGN ++W+S   +GF GSRK++PFA
Sbjct: 6   KKVTRVKRRERKNIEKGHAHIQSTFNNTIITLTDVHGNALSWASAGQLGFKGSRKSTPFA 65

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  +  A  HG+ S+EV V G G+GR++A+RAL+A G  +  I DVT I HNGCR
Sbjct: 66  AQMAAETATKGAMEHGLRSVEVFVKGPGSGREAAIRALQAAGLDVTMIKDVTPIPHNGCR 125

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 126 PPKRRRV 132


>gi|39997925|ref|NP_953876.1| 30S ribosomal protein S11 [Geobacter sulfurreducens PCA]
 gi|59798800|sp|Q749B1|RS11_GEOSL RecName: Full=30S ribosomal protein S11
 gi|39984870|gb|AAR36226.1| ribosomal protein S11 [Geobacter sulfurreducens PCA]
 gi|298506863|gb|ADI85586.1| ribosomal protein S11 [Geobacter sulfurreducens KN400]
          Length = 131

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 89/115 (77%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI +G AH+ +TFNNT ITITDP GN +AWSS    GF GSRK++PFAAQ+A ++C+ KA
Sbjct: 17  NIPNGVAHIQATFNNTIITITDPVGNVVAWSSAGSKGFKGSRKSTPFAAQIAAEECARKA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           Q HGM S+EV V G G+GR+SALRAL+A GF +  I DVT I HNGCRP KRRR+
Sbjct: 77  QEHGMRSVEVFVKGPGSGRESALRALQAAGFHVNFIRDVTPIPHNGCRPPKRRRV 131


>gi|189424435|ref|YP_001951612.1| 30S ribosomal protein S11 [Geobacter lovleyi SZ]
 gi|189420694|gb|ACD95092.1| ribosomal protein S11 [Geobacter lovleyi SZ]
          Length = 130

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 71/115 (61%), Positives = 88/115 (76%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI +G AH+ +TFNNT ITITDP GN +AWS+    GF GSRK++PFAAQVA +DC+ KA
Sbjct: 16  NITNGVAHIQATFNNTIITITDPVGNVVAWSTAGAKGFKGSRKSTPFAAQVAAEDCARKA 75

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           Q HG+ ++EV V G G+GR+SALRAL+A G  +  I DVT I HNGCRP KRRR+
Sbjct: 76  QEHGLRNIEVYVKGPGSGRESALRALQATGLNVSFIRDVTPIPHNGCRPPKRRRV 130


>gi|295398313|ref|ZP_06808355.1| 30S ribosomal protein S11 [Aerococcus viridans ATCC 11563]
 gi|294973452|gb|EFG49237.1| 30S ribosomal protein S11 [Aerococcus viridans ATCC 11563]
          Length = 129

 Score =  148 bits (374), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 94/129 (72%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K P   + R +KN+ +G AH+ STFNNT + ITD HGN I+WSS   +GF GSRK++P
Sbjct: 1   MAKRPVSRKRRVKKNVETGVAHIHSTFNNTIVMITDEHGNAISWSSAGALGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A++  +  A +HGM S+EV V G G+GR+SA+RAL+A G  + +I DVT I HNG
Sbjct: 61  YAAQMASETATKAAMDHGMKSVEVSVKGPGSGRESAIRALQAAGLEVTAIRDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|85858171|ref|YP_460373.1| 30S ribosomal protein S11 [Syntrophus aciditrophicus SB]
 gi|123752427|sp|Q2LQD1|RS11_SYNAS RecName: Full=30S ribosomal protein S11
 gi|85721262|gb|ABC76205.1| SSU ribosomal protein S11P [Syntrophus aciditrophicus SB]
          Length = 130

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 72/115 (62%), Positives = 87/115 (75%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI  G AH+ STFNNT ITITDP GN IAWSS  + GF GSRK++PFAAQ+A +DC  KA
Sbjct: 16  NIPEGIAHIQSTFNNTIITITDPIGNVIAWSSSGMQGFKGSRKSTPFAAQMAAEDCVKKA 75

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + HG+  ++V V G G+GR+SALR+L+A G TI  I DVT I HNGCRP KRRR+
Sbjct: 76  KEHGLRKVQVYVKGPGSGRESALRSLQAAGLTISLIRDVTPIPHNGCRPPKRRRV 130


>gi|308048014|ref|YP_003911580.1| 30S ribosomal protein S11P [Ferrimonas balearica DSM 9799]
 gi|307630204|gb|ADN74506.1| SSU ribosomal protein S11P [Ferrimonas balearica DSM 9799]
          Length = 129

 Score =  147 bits (370), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 94/129 (72%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+PSR R + RK +  G AHV ++FNNT +TITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKTPSRTRKKVRKQVADGIAHVHASFNNTIVTITDRQGNALAWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+  A+ +G+ +LEV+V G G GR+S++RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEIAKEYGLKNLEVEVKGPGPGRESSIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|257064664|ref|YP_003144336.1| SSU ribosomal protein S11P [Slackia heliotrinireducens DSM 20476]
 gi|256792317|gb|ACV22987.1| SSU ribosomal protein S11P [Slackia heliotrinireducens DSM 20476]
          Length = 131

 Score =  147 bits (370), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 91/124 (73%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R++  +RKNI  G+AH+ STFNNT ++ITDP GN IAW+S   VGF GSRK++PFAAQ+
Sbjct: 8   TRVKRADRKNIAVGQAHIKSTFNNTIVSITDPQGNVIAWNSAGTVGFKGSRKSTPFAAQM 67

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A + C+  A  HG+  + V V G G+GR++A+R+L+A G  + SI D T I HNGCRP K
Sbjct: 68  AAEQCAKNAMEHGLKKVAVFVKGPGSGRETAIRSLQAAGLEVTSIQDCTPIPHNGCRPCK 127

Query: 126 RRRI 129
           RRR+
Sbjct: 128 RRRV 131


>gi|296445046|ref|ZP_06887007.1| 30S ribosomal protein S11 [Methylosinus trichosporium OB3b]
 gi|296257467|gb|EFH04533.1| 30S ribosomal protein S11 [Methylosinus trichosporium OB3b]
          Length = 129

 Score =  147 bits (370), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 95/116 (81%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           KNIVSG AHV STFNNT ITITD  GNT++WSS   +GF GSRK++P+AAQ+A +D + K
Sbjct: 14  KNIVSGVAHVNSTFNNTMITITDAQGNTVSWSSAGSMGFKGSRKSTPYAAQMAAEDAARK 73

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           A  HG+ +LEV+VSG G+GR+SALRAL+A GFT+ SI DVT I HNGCRPRKRRR+
Sbjct: 74  AGEHGVRTLEVEVSGPGSGRESALRALQAAGFTVTSIRDVTPIPHNGCRPRKRRRV 129


>gi|74316446|ref|YP_314186.1| 30S ribosomal protein S11 [Thiobacillus denitrificans ATCC 25259]
 gi|91207685|sp|Q3SLM6|RS11_THIDA RecName: Full=30S ribosomal protein S11
 gi|74055941|gb|AAZ96381.1| ribosomal protein S11 [Thiobacillus denitrificans ATCC 25259]
          Length = 130

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 66/127 (51%), Positives = 94/127 (74%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K+ +R+R + +KN+  G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++PFA
Sbjct: 4   KTAARVRKKVKKNVAEGIAHIHASFNNTIVTITDRQGNALSWATAGGAGFKGSRKSTPFA 63

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQVA ++    AQ +G+ +LEV++ G G GR+S +RAL A+GF IV+I DVT I HNGCR
Sbjct: 64  AQVAAENAGKMAQEYGVKNLEVRIKGPGPGRESTVRALNALGFKIVAISDVTPIPHNGCR 123

Query: 123 PRKRRRI 129
           P K+RRI
Sbjct: 124 PSKKRRI 130


>gi|82701923|ref|YP_411489.1| 30S ribosomal protein S11 [Nitrosospira multiformis ATCC 25196]
 gi|91207661|sp|Q2YAX4|RS11_NITMU RecName: Full=30S ribosomal protein S11
 gi|82409988|gb|ABB74097.1| SSU ribosomal protein S11P [Nitrosospira multiformis ATCC 25196]
          Length = 129

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 93/129 (72%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+ +R+R + +KN+  G AHV ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MVKAATRVRKKVKKNVAEGIAHVHASFNNTIVTITDRQGNALSWATSGGAGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     AQ +G+ +LEV++ G G GR+SA+RAL A GF I SI DVT + HNG
Sbjct: 61  FAAQVAAEQAGRAAQEYGVKNLEVRIKGPGPGRESAVRALNAAGFKITSISDVTPVPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RRI
Sbjct: 121 CRPPKKRRI 129


>gi|306821593|ref|ZP_07455191.1| 30S ribosomal protein S11 [Eubacterium yurii subsp. margaretiae
           ATCC 43715]
 gi|304550338|gb|EFM38331.1| 30S ribosomal protein S11 [Eubacterium yurii subsp. margaretiae
           ATCC 43715]
          Length = 133

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 92/127 (72%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K  +R+R +ERKNI  G AH+ STFNNT +T++D  GN I+W+S   +GF GSRK++PFA
Sbjct: 7   KKVTRVRRKERKNIEKGHAHIQSTFNNTIVTLSDVQGNAISWASAGQLGFKGSRKSTPFA 66

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  +  A  HG+ S++V V G GAGR++A+RAL+A G  +  I DVT I HNGCR
Sbjct: 67  AQMAAETATKAAIEHGLKSVDVFVKGPGAGREAAIRALQAAGLEVTMIKDVTPIPHNGCR 126

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 127 PPKRRRV 133


>gi|124268603|ref|YP_001022607.1| 30S ribosomal protein S11 [Methylibium petroleiphilum PM1]
 gi|152060792|sp|A2SLD3|RS11_METPP RecName: Full=30S ribosomal protein S11
 gi|124261378|gb|ABM96372.1| SSU ribosomal protein S11P [Methylibium petroleiphilum PM1]
          Length = 133

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/133 (54%), Positives = 96/133 (72%), Gaps = 4/133 (3%)

Query: 1   MPKSPS----RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSR 56
           M K+P+    R+R + RKN+  G AHV ++FNNT ITITD  GN +AW+S    GF GSR
Sbjct: 1   MAKAPNTAAQRVRKKVRKNVSDGVAHVHASFNNTIITITDRQGNALAWASSGGQGFKGSR 60

Query: 57  KNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMI 116
           K++PFAAQVA +     AQ+ G+ +LEV++ G G GR+S++RAL A+G  IVSI DVT +
Sbjct: 61  KSTPFAAQVAAEVAGRAAQDQGIKNLEVEIKGPGPGRESSVRALAALGIRIVSISDVTPV 120

Query: 117 AHNGCRPRKRRRI 129
            HNGCRP+KRRRI
Sbjct: 121 PHNGCRPQKRRRI 133


>gi|88854651|ref|ZP_01129317.1| 30S ribosomal protein S11 [marine actinobacterium PHSC20C1]
 gi|88815812|gb|EAR25668.1| 30S ribosomal protein S11 [marine actinobacterium PHSC20C1]
          Length = 132

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 96/129 (74%), Gaps = 1/129 (0%)

Query: 2   PKSPSRI-RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           PKS +R  R +E+KN+  G+AH+ STFNNT +TITDP G  +AWSS  VVGF GSRK++P
Sbjct: 4   PKSAARKPRRKEKKNVAVGQAHIKSTFNNTIVTITDPTGAVLAWSSSGVVGFKGSRKSTP 63

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ++ +  + +AQ HG+  ++V V G G+GR++A+R+L+A G  + SI DVT   HNG
Sbjct: 64  YAAQMSAESAARQAQEHGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGSINDVTPQTHNG 123

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 124 CRPPKRRRV 132


>gi|224370667|ref|YP_002604831.1| RpsK [Desulfobacterium autotrophicum HRM2]
 gi|223693384|gb|ACN16667.1| RpsK [Desulfobacterium autotrophicum HRM2]
          Length = 131

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/115 (61%), Positives = 86/115 (74%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI +G  H+ STFNNT +TITD  GNTI+WSS  + GF GSRK++PFAA++A +D  AKA
Sbjct: 17  NISTGVVHIQSTFNNTIVTITDEIGNTISWSSSGIQGFKGSRKSTPFAAKLAAEDAGAKA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HGM ++ V V G GAGR+SALRAL A GF I  I DVT +AHNGCRP KRRR+
Sbjct: 77  MEHGMKNVSVYVKGPGAGRESALRALHAQGFNISFIKDVTPVAHNGCRPPKRRRV 131


>gi|294675882|ref|YP_003576497.1| 30S ribosomal protein S11 [Rhodobacter capsulatus SB 1003]
 gi|294474702|gb|ADE84090.1| 30S ribosomal protein S11 [Rhodobacter capsulatus SB 1003]
          Length = 129

 Score =  144 bits (362), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 73/129 (56%), Positives = 99/129 (76%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  +R++ +ERKNI +G  HV S+FNNT+I I+D  GN I+WSS   +GF GSRK++P
Sbjct: 1   MARDKTRVKRKERKNIAAGVVHVNSSFNNTKILISDVQGNAISWSSSGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D + KAQ HG+ +++V+V G G+GR+SALRAL A+G  I SI DVT IAHNG
Sbjct: 61  YAAQMAAEDAARKAQEHGLKTVDVEVQGPGSGRESALRALAAVGLNITSIRDVTPIAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|15642568|ref|NP_232201.1| 30S ribosomal protein S11 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|27364192|ref|NP_759720.1| 30S ribosomal protein S11 [Vibrio vulnificus CMCP6]
 gi|28897054|ref|NP_796659.1| 30S ribosomal protein S11 [Vibrio parahaemolyticus RIMD 2210633]
 gi|37678581|ref|NP_933190.1| 30S ribosomal protein S11 [Vibrio vulnificus YJ016]
 gi|147673111|ref|YP_001218067.1| 30S ribosomal protein S11 [Vibrio cholerae O395]
 gi|149192392|ref|ZP_01870593.1| 30S ribosomal protein S11 [Vibrio shilonii AK1]
 gi|153217777|ref|ZP_01951420.1| ribosomal protein S11 [Vibrio cholerae 1587]
 gi|153827708|ref|ZP_01980375.1| ribosomal protein S11 [Vibrio cholerae MZO-2]
 gi|153840231|ref|ZP_01992898.1| ribosomal protein S11 [Vibrio parahaemolyticus AQ3810]
 gi|156973073|ref|YP_001443980.1| 30S ribosomal protein S11 [Vibrio harveyi ATCC BAA-1116]
 gi|227082690|ref|YP_002811241.1| ribosomal protein S11 [Vibrio cholerae M66-2]
 gi|229507375|ref|ZP_04396880.1| SSU ribosomal protein S11p (S14e) [Vibrio cholerae BX 330286]
 gi|229509701|ref|ZP_04399182.1| SSU ribosomal protein S11p (S14e) [Vibrio cholerae B33]
 gi|229513496|ref|ZP_04402960.1| SSU ribosomal protein S11p (S14e) [Vibrio cholerae TMA 21]
 gi|229516826|ref|ZP_04406272.1| SSU ribosomal protein S11p (S14e) [Vibrio cholerae RC9]
 gi|229521639|ref|ZP_04411057.1| SSU ribosomal protein S11p (S14e) [Vibrio cholerae TM 11079-80]
 gi|229524554|ref|ZP_04413959.1| SSU ribosomal protein S11p (S14e) [Vibrio cholerae bv. albensis
           VL426]
 gi|229527497|ref|ZP_04416889.1| SSU ribosomal protein S11p (S14e) [Vibrio cholerae 12129(1)]
 gi|229606881|ref|YP_002877529.1| 30S ribosomal protein S11 [Vibrio cholerae MJ-1236]
 gi|254292240|ref|ZP_04963003.1| ribosomal protein S11 [Vibrio cholerae AM-19226]
 gi|254509450|ref|ZP_05121528.1| ribosomal protein S11 [Vibrio parahaemolyticus 16]
 gi|254851113|ref|ZP_05240463.1| ribosomal protein S11 [Vibrio cholerae MO10]
 gi|255744458|ref|ZP_05418410.1| SSU ribosomal protein S11p (S14e) [Vibrio cholera CIRS 101]
 gi|258622735|ref|ZP_05717753.1| 30S ribosomal protein S11 [Vibrio mimicus VM573]
 gi|258625763|ref|ZP_05720642.1| 30S ribosomal protein S11 [Vibrio mimicus VM603]
 gi|260361370|ref|ZP_05774435.1| 30S ribosomal protein S11 [Vibrio parahaemolyticus K5030]
 gi|260770936|ref|ZP_05879865.1| SSU ribosomal protein S11p (S14e) [Vibrio furnissii CIP 102972]
 gi|260772119|ref|ZP_05881036.1| SSU ribosomal protein S11p (S14e) [Vibrio metschnikovii CIP 69.14]
 gi|260779480|ref|ZP_05888370.1| SSU ribosomal protein S11p (S14e) [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260877972|ref|ZP_05890327.1| 30S ribosomal protein S11 [Vibrio parahaemolyticus AN-5034]
 gi|260895672|ref|ZP_05904168.1| 30S ribosomal protein S11 [Vibrio parahaemolyticus Peru-466]
 gi|260903550|ref|ZP_05911945.1| 30S ribosomal protein S11 [Vibrio parahaemolyticus AQ4037]
 gi|261211128|ref|ZP_05925417.1| SSU ribosomal protein S11p (S14e) [Vibrio sp. RC341]
 gi|261250394|ref|ZP_05942969.1| SSU ribosomal protein S11p (S14e) [Vibrio orientalis CIP 102891]
 gi|262166594|ref|ZP_06034331.1| SSU ribosomal protein S11p (S14e) [Vibrio mimicus VM223]
 gi|262170490|ref|ZP_06038168.1| SSU ribosomal protein S11p (S14e) [Vibrio mimicus MB-451]
 gi|262392493|ref|YP_003284347.1| 30S ribosomal protein S11p [Vibrio sp. Ex25]
 gi|262401860|ref|ZP_06078425.1| SSU ribosomal protein S11p (S14e) [Vibrio sp. RC586]
 gi|269959711|ref|ZP_06174091.1| 30S ribosomal protein S11 [Vibrio harveyi 1DA3]
 gi|269964714|ref|ZP_06178952.1| 30S ribosomal protein S11 [Vibrio alginolyticus 40B]
 gi|297581415|ref|ZP_06943338.1| ribosomal protein S11 [Vibrio cholerae RC385]
 gi|298500603|ref|ZP_07010407.1| SSU ribosomal protein S11 [Vibrio cholerae MAK 757]
 gi|312884680|ref|ZP_07744381.1| 30S ribosomal protein S11 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|320157578|ref|YP_004189957.1| 30S ribosomal protein S11p (S14e) [Vibrio vulnificus MO6-24/O]
 gi|323492142|ref|ZP_08097304.1| 30S ribosomal protein S11 [Vibrio brasiliensis LMG 20546]
 gi|323495527|ref|ZP_08100601.1| 30S ribosomal protein S11 [Vibrio sinaloensis DSM 21326]
 gi|54039340|sp|P66368|RS11_VIBPA RecName: Full=30S ribosomal protein S11
 gi|54039341|sp|P66369|RS11_VIBVU RecName: Full=30S ribosomal protein S11
 gi|54042114|sp|P66367|RS11_VIBCH RecName: Full=30S ribosomal protein S11
 gi|59798815|sp|Q7MPG6|RS11_VIBVY RecName: Full=30S ribosomal protein S11
 gi|166231842|sp|A7N0H6|RS11_VIBHB RecName: Full=30S ribosomal protein S11
 gi|172047567|sp|A5F574|RS11_VIBC3 RecName: Full=30S ribosomal protein S11
 gi|254811056|sp|C3LRN5|RS11_VIBCM RecName: Full=30S ribosomal protein S11
 gi|9657159|gb|AAF95714.1| ribosomal protein S11 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|27360310|gb|AAO09247.1| SSU ribosomal protein S11p (S14e) [Vibrio vulnificus CMCP6]
 gi|28805262|dbj|BAC58543.1| ribosomal protein S11 [Vibrio parahaemolyticus RIMD 2210633]
 gi|37197321|dbj|BAC93161.1| ribosomal protein S11 [Vibrio vulnificus YJ016]
 gi|124113314|gb|EAY32134.1| ribosomal protein S11 [Vibrio cholerae 1587]
 gi|146314994|gb|ABQ19533.1| ribosomal protein S11 [Vibrio cholerae O395]
 gi|148833783|gb|EDL50819.1| 30S ribosomal protein S11 [Vibrio shilonii AK1]
 gi|149737817|gb|EDM52722.1| ribosomal protein S11 [Vibrio cholerae MZO-2]
 gi|149746108|gb|EDM57238.1| ribosomal protein S11 [Vibrio parahaemolyticus AQ3810]
 gi|150421842|gb|EDN13826.1| ribosomal protein S11 [Vibrio cholerae AM-19226]
 gi|156524667|gb|ABU69753.1| hypothetical protein VIBHAR_00752 [Vibrio harveyi ATCC BAA-1116]
 gi|219547623|gb|EED24670.1| ribosomal protein S11 [Vibrio parahaemolyticus 16]
 gi|227010578|gb|ACP06790.1| ribosomal protein S11 [Vibrio cholerae M66-2]
 gi|227014462|gb|ACP10672.1| ribosomal protein S11 [Vibrio cholerae O395]
 gi|229335129|gb|EEO00614.1| SSU ribosomal protein S11p (S14e) [Vibrio cholerae 12129(1)]
 gi|229338135|gb|EEO03152.1| SSU ribosomal protein S11p (S14e) [Vibrio cholerae bv. albensis
           VL426]
 gi|229341233|gb|EEO06237.1| SSU ribosomal protein S11p (S14e) [Vibrio cholerae TM 11079-80]
 gi|229345889|gb|EEO10861.1| SSU ribosomal protein S11p (S14e) [Vibrio cholerae RC9]
 gi|229349373|gb|EEO14329.1| SSU ribosomal protein S11p (S14e) [Vibrio cholerae TMA 21]
 gi|229353175|gb|EEO18114.1| SSU ribosomal protein S11p (S14e) [Vibrio cholerae B33]
 gi|229354880|gb|EEO19801.1| SSU ribosomal protein S11p (S14e) [Vibrio cholerae BX 330286]
 gi|229369536|gb|ACQ59959.1| SSU ribosomal protein S11p (S14e) [Vibrio cholerae MJ-1236]
 gi|254846818|gb|EET25232.1| ribosomal protein S11 [Vibrio cholerae MO10]
 gi|255737983|gb|EET93376.1| SSU ribosomal protein S11p (S14e) [Vibrio cholera CIRS 101]
 gi|258582001|gb|EEW06871.1| 30S ribosomal protein S11 [Vibrio mimicus VM603]
 gi|258584923|gb|EEW09654.1| 30S ribosomal protein S11 [Vibrio mimicus VM573]
 gi|260604289|gb|EEX30593.1| SSU ribosomal protein S11p (S14e) [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260612986|gb|EEX38188.1| SSU ribosomal protein S11p (S14e) [Vibrio metschnikovii CIP 69.14]
 gi|260614173|gb|EEX39363.1| SSU ribosomal protein S11p (S14e) [Vibrio furnissii CIP 102972]
 gi|260839629|gb|EEX66240.1| SSU ribosomal protein S11p (S14e) [Vibrio sp. RC341]
 gi|260938963|gb|EEX94950.1| SSU ribosomal protein S11p (S14e) [Vibrio orientalis CIP 102891]
 gi|261891566|gb|EEY37552.1| SSU ribosomal protein S11p (S14e) [Vibrio mimicus MB-451]
 gi|262026310|gb|EEY44978.1| SSU ribosomal protein S11p (S14e) [Vibrio mimicus VM223]
 gi|262336087|gb|ACY49882.1| SSU ribosomal protein S11p (S14e) [Vibrio sp. Ex25]
 gi|262351832|gb|EEZ00963.1| SSU ribosomal protein S11p (S14e) [Vibrio sp. RC586]
 gi|269830613|gb|EEZ84834.1| 30S ribosomal protein S11 [Vibrio alginolyticus 40B]
 gi|269835634|gb|EEZ89713.1| 30S ribosomal protein S11 [Vibrio harveyi 1DA3]
 gi|297534253|gb|EFH73091.1| ribosomal protein S11 [Vibrio cholerae RC385]
 gi|297540772|gb|EFH76829.1| SSU ribosomal protein S11 [Vibrio cholerae MAK 757]
 gi|308089503|gb|EFO39198.1| 30S ribosomal protein S11 [Vibrio parahaemolyticus Peru-466]
 gi|308089742|gb|EFO39437.1| 30S ribosomal protein S11 [Vibrio parahaemolyticus AN-5034]
 gi|308109056|gb|EFO46596.1| 30S ribosomal protein S11 [Vibrio parahaemolyticus AQ4037]
 gi|308114567|gb|EFO52107.1| 30S ribosomal protein S11 [Vibrio parahaemolyticus K5030]
 gi|309367593|gb|EFP95144.1| 30S ribosomal protein S11 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|319932890|gb|ADV87754.1| SSU ribosomal protein S11p (S14e) [Vibrio vulnificus MO6-24/O]
 gi|323313703|gb|EGA66805.1| 30S ribosomal protein S11 [Vibrio brasiliensis LMG 20546]
 gi|323319408|gb|EGA72345.1| 30S ribosomal protein S11 [Vibrio sinaloensis DSM 21326]
 gi|327485055|gb|AEA79462.1| SSU ribosomal protein S11p (S14e) [Vibrio cholerae LMA3894-4]
 gi|328471857|gb|EGF42734.1| 30S ribosomal protein S11 [Vibrio parahaemolyticus 10329]
          Length = 129

 Score =  143 bits (361), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 90/129 (69%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K P+R R R RK +  G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKQPTRARKRVRKQVADGVAHIHASFNNTIVTITDRQGNALAWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+  A+ +G+ +LEV V G G GR+S +RAL A GF I +I D T I HNG
Sbjct: 61  FAAQVAAERCAEMAKEYGLKNLEVMVKGPGPGRESTVRALNAAGFRITNIVDATPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|298243943|ref|ZP_06967750.1| 30S ribosomal protein S11 [Ktedonobacter racemifer DSM 44963]
 gi|297556997|gb|EFH90861.1| 30S ribosomal protein S11 [Ktedonobacter racemifer DSM 44963]
          Length = 133

 Score =  143 bits (361), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 92/123 (74%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R RERK+I  G+AH+ +TFNNT +T+TDP+GN I+W S    GF GSRK++P+AAQV 
Sbjct: 11  KVRRRERKSIPRGQAHIQATFNNTIVTLTDPNGNVISWGSAGAQGFKGSRKSTPYAAQVT 70

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +A +HG+  ++V V G G+GR++A+R+L+A G  + SI DVT I HNGCRP KR
Sbjct: 71  AETAARRAMDHGLKQIDVFVKGPGSGREAAIRSLQASGLNVTSITDVTPIPHNGCRPPKR 130

Query: 127 RRI 129
           RR+
Sbjct: 131 RRV 133


>gi|56460993|ref|YP_156274.1| 30S ribosomal protein S11 [Idiomarina loihiensis L2TR]
 gi|62287389|sp|Q5QXV6|RS11_IDILO RecName: Full=30S ribosomal protein S11
 gi|56180003|gb|AAV82725.1| Ribosomal protein S11 [Idiomarina loihiensis L2TR]
          Length = 129

 Score =  143 bits (360), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 93/129 (72%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P+R R R +K +  G AHV ++FNNT ITITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKTPTRSRKRVKKQVADGMAHVHASFNNTIITITDRQGNALAWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     A+ +G+ +LEV V+G G GR+S++RAL A+G+ I +I DVT I HNG
Sbjct: 61  FAAQVAAERAGEMAKEYGLKNLEVFVNGPGPGRESSIRALNAVGYKITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|30248441|ref|NP_840511.1| 30S ribosomal protein S11 [Nitrosomonas europaea ATCC 19718]
 gi|34925212|sp|Q82X71|RS11_NITEU RecName: Full=30S ribosomal protein S11
 gi|30138327|emb|CAD84335.1| Ribosomal protein S11 [Nitrosomonas europaea ATCC 19718]
          Length = 129

 Score =  143 bits (360), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 92/129 (71%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K   +IR + +KN+V G AH+ ++FNNT +TI+D  GN ++W++   VGF GSRK++P
Sbjct: 1   MVKPSLKIRKKVKKNVVEGVAHIHASFNNTIVTISDRQGNALSWATSGGVGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     A  +G+ +LEV+V G G GRDSA+RAL A GF I SI DVT I HNG
Sbjct: 61  FAAQVAAEHAGRAALEYGVKNLEVRVKGPGPGRDSAVRALNATGFKITSITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RRI
Sbjct: 121 CRPPKKRRI 129


>gi|86148805|ref|ZP_01067072.1| 30S ribosomal protein S11 [Vibrio sp. MED222]
 gi|148982228|ref|ZP_01816654.1| 30S ribosomal protein S11 [Vibrionales bacterium SWAT-3]
 gi|218710726|ref|YP_002418347.1| 30S ribosomal protein S11 [Vibrio splendidus LGP32]
 gi|254811057|sp|B7VLD4|RS11_VIBSL RecName: Full=30S ribosomal protein S11
 gi|85833395|gb|EAQ51586.1| 30S ribosomal protein S11 [Vibrio sp. MED222]
 gi|145960590|gb|EDK25943.1| 30S ribosomal protein S11 [Vibrionales bacterium SWAT-3]
 gi|218323745|emb|CAV20099.1| Ribosomal protein S11 [Vibrio splendidus LGP32]
          Length = 129

 Score =  143 bits (360), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K P+R R R RK +  G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKQPTRARKRVRKQVADGVAHIHASFNNTIVTITDRQGNALAWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C   A+ +G+ +LEV V G G GR+S +RAL A GF I +I D T I HNG
Sbjct: 61  FAAQVAAERCGEMAKEYGLKNLEVMVKGPGPGRESTVRALNAAGFRITNIVDATPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|126697667|ref|YP_001086564.1| 30S ribosomal protein S11 [Clostridium difficile 630]
 gi|254973758|ref|ZP_05270230.1| 30S ribosomal protein S11 [Clostridium difficile QCD-66c26]
 gi|255091148|ref|ZP_05320626.1| 30S ribosomal protein S11 [Clostridium difficile CIP 107932]
 gi|255099259|ref|ZP_05328236.1| 30S ribosomal protein S11 [Clostridium difficile QCD-63q42]
 gi|255305042|ref|ZP_05349214.1| 30S ribosomal protein S11 [Clostridium difficile ATCC 43255]
 gi|255312802|ref|ZP_05354385.1| 30S ribosomal protein S11 [Clostridium difficile QCD-76w55]
 gi|255515561|ref|ZP_05383237.1| 30S ribosomal protein S11 [Clostridium difficile QCD-97b34]
 gi|255648656|ref|ZP_05395558.1| 30S ribosomal protein S11 [Clostridium difficile QCD-37x79]
 gi|255654189|ref|ZP_05399598.1| 30S ribosomal protein S11 [Clostridium difficile QCD-23m63]
 gi|260681873|ref|YP_003213158.1| 30S ribosomal protein S11 [Clostridium difficile CD196]
 gi|260685471|ref|YP_003216604.1| 30S ribosomal protein S11 [Clostridium difficile R20291]
 gi|296449772|ref|ZP_06891541.1| 30S ribosomal protein S11 [Clostridium difficile NAP08]
 gi|296877836|ref|ZP_06901858.1| 30S ribosomal protein S11 [Clostridium difficile NAP07]
 gi|306518779|ref|ZP_07405126.1| 30S ribosomal protein S11 [Clostridium difficile QCD-32g58]
 gi|122974221|sp|Q18CI7|RS11_CLOD6 RecName: Full=30S ribosomal protein S11
 gi|115249104|emb|CAJ66915.1| 30S ribosomal protein S11 [Clostridium difficile]
 gi|260208036|emb|CBA60235.1| 30S ribosomal protein S11 [Clostridium difficile CD196]
 gi|260211487|emb|CBE01625.1| 30S ribosomal protein S11 [Clostridium difficile R20291]
 gi|296261370|gb|EFH08196.1| 30S ribosomal protein S11 [Clostridium difficile NAP08]
 gi|296431136|gb|EFH16961.1| 30S ribosomal protein S11 [Clostridium difficile NAP07]
          Length = 132

 Score =  143 bits (360), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 72/127 (56%), Positives = 93/127 (73%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K  +RIR RERKNI  G AH+ STFNNT IT+TD HGN I+W+S   +GF GSRK++PFA
Sbjct: 6   KKVTRIRRRERKNIERGHAHIQSTFNNTIITLTDVHGNAISWASSGQLGFKGSRKSTPFA 65

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           +Q+A +  +  A  HG+ S+EV V G G+GR++A+RAL+A G  +  I DVT I HNGCR
Sbjct: 66  SQMAAETAAKAAMEHGLKSVEVFVKGPGSGREAAIRALQATGLEVTMIKDVTPIPHNGCR 125

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 126 PPKRRRV 132


>gi|253995742|ref|YP_003047806.1| 30S ribosomal protein S11 [Methylotenera mobilis JLW8]
 gi|297537554|ref|YP_003673323.1| 30S ribosomal protein S11 [Methylotenera sp. 301]
 gi|253982421|gb|ACT47279.1| ribosomal protein S11 [Methylotenera mobilis JLW8]
 gi|297256901|gb|ADI28746.1| 30S ribosomal protein S11 [Methylotenera sp. 301]
          Length = 129

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 92/129 (71%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+  R+R + +KNI  G AHV ++FNNT ITITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKANVRVRKKVKKNIAEGIAHVHASFNNTIITITDRQGNALSWATSGGQGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     AQ +G+ +LEV++ G G GR+SA+RAL A GF I SI DVT + HNG
Sbjct: 61  FAAQVAAEVAGKSAQENGVKNLEVRIKGPGPGRESAVRALNAAGFKITSITDVTPVPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RRI
Sbjct: 121 CRPPKKRRI 129


>gi|262273356|ref|ZP_06051170.1| SSU ribosomal protein S11p (S14e) [Grimontia hollisae CIP 101886]
 gi|262222334|gb|EEY73645.1| SSU ribosomal protein S11p (S14e) [Grimontia hollisae CIP 101886]
          Length = 129

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K P+R R R RK +  G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKQPNRARKRVRKQVADGVAHIHASFNNTIVTITDRQGNALAWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C   A+ +G+ +LEV V G G GR+S +RAL A GF I +I D T I HNG
Sbjct: 61  FAAQVAAERCGEMAKEYGLKNLEVMVKGPGPGRESTIRALNAAGFRITNIVDATPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|163752125|ref|ZP_02159330.1| 30S ribosomal protein S11 [Shewanella benthica KT99]
 gi|161327960|gb|EDP99135.1| 30S ribosomal protein S11 [Shewanella benthica KT99]
          Length = 130

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 71/130 (54%), Positives = 94/130 (72%), Gaps = 1/130 (0%)

Query: 1   MPKSPSR-IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           M KSPSR  R R RK +  G AH+ ++FNNT ITITD  GNT++W++    GF GSRK++
Sbjct: 1   MAKSPSRSPRKRVRKQVADGMAHIHASFNNTIITITDRQGNTLSWATSGGSGFRGSRKST 60

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           PFAAQVA +     AQ++G+ +LEV V G G GR+SA+RAL ++G+ I +I DVT I HN
Sbjct: 61  PFAAQVAAERAGVAAQDYGVKNLEVFVKGPGPGRESAIRALNSVGYKITNITDVTPIPHN 120

Query: 120 GCRPRKRRRI 129
           GCRP K+RR+
Sbjct: 121 GCRPPKKRRV 130


>gi|322515612|ref|ZP_08068591.1| 30S ribosomal protein S11 [Actinobacillus ureae ATCC 25976]
 gi|322118322|gb|EFX90597.1| 30S ribosomal protein S11 [Actinobacillus ureae ATCC 25976]
          Length = 129

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 90/129 (69%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R +K IV G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKTPVRARKRVKKQIVDGVAHIHASFNNTIVTITDRQGNALAWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   +  G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEAVKEFGLKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|159901449|ref|YP_001547696.1| 30S ribosomal protein S11 [Herpetosiphon aurantiacus ATCC 23779]
 gi|226708378|sp|A9B435|RS11_HERA2 RecName: Full=30S ribosomal protein S11
 gi|159894488|gb|ABX07568.1| ribosomal protein S11 [Herpetosiphon aurantiacus ATCC 23779]
          Length = 137

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 66/116 (56%), Positives = 87/116 (75%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           KN+  G+AHV +TFNNT +TITDP GN + WSS    GF GSRK++P+AAQV  +  + K
Sbjct: 22  KNVPRGQAHVQATFNNTIVTITDPAGNVVCWSSAGASGFKGSRKSTPYAAQVTAEQAARK 81

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           A ++GM  +EV V G GAGR+SA+RAL+A G ++++I DVT I HNGCRP KRRR+
Sbjct: 82  AMDNGMRVVEVYVKGPGAGRESAVRALQATGLSVIAITDVTPIPHNGCRPPKRRRV 137


>gi|167855327|ref|ZP_02478095.1| 50S ribosomal protein L17 [Haemophilus parasuis 29755]
 gi|219871573|ref|YP_002475948.1| 30S ribosomal protein S11 [Haemophilus parasuis SH0165]
 gi|254765386|sp|B8F6P8|RS11_HAEPS RecName: Full=30S ribosomal protein S11
 gi|167853585|gb|EDS24831.1| 50S ribosomal protein L17 [Haemophilus parasuis 29755]
 gi|219691777|gb|ACL33000.1| 30S ribosomal protein S11 [Haemophilus parasuis SH0165]
          Length = 129

 Score =  142 bits (358), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 90/129 (69%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R +K IV G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKTPVRARKRVKKQIVDGVAHIHASFNNTIVTITDRQGNALAWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   +  G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEMVKEFGLKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|291613260|ref|YP_003523417.1| 30S ribosomal protein S11 [Sideroxydans lithotrophicus ES-1]
 gi|291583372|gb|ADE11030.1| 30S ribosomal protein S11 [Sideroxydans lithotrophicus ES-1]
          Length = 129

 Score =  142 bits (358), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 91/129 (70%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R+R + +KN+  G AHV ++FNNT +TITD  GNT+AWS+    GF GSRK++P
Sbjct: 1   MAKPSTRVRKKVKKNVAEGIAHVHASFNNTIVTITDRQGNTLAWSTSGAQGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +     A   G+ +LEV++ G G GR+SA+RAL A GF I SI D+T + HNG
Sbjct: 61  FAAQIAAETVGKSAVECGVKNLEVRIKGPGPGRESAVRALNAAGFKITSISDITPVPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RRI
Sbjct: 121 CRPPKKRRI 129


>gi|114330596|ref|YP_746818.1| 30S ribosomal protein S11 [Nitrosomonas eutropha C91]
 gi|122314410|sp|Q0AIH3|RS11_NITEC RecName: Full=30S ribosomal protein S11
 gi|114307610|gb|ABI58853.1| SSU ribosomal protein S11P [Nitrosomonas eutropha C91]
          Length = 129

 Score =  142 bits (358), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 92/129 (71%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K P + R + +KNI+ G AH+ ++FNNT +TI+D  GN ++W++   VGF GSRK++P
Sbjct: 1   MIKPPLKSRKKIKKNIIEGVAHIHASFNNTIVTISDRQGNALSWATSGGVGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     A  +G+ +LE++V G G GRDSA+RAL A GF I SI DVT + HNG
Sbjct: 61  FAAQVAAEHAGRAALEYGVKNLEIRVKGPGPGRDSAVRALNATGFKITSITDVTPVPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RRI
Sbjct: 121 CRPPKKRRI 129


>gi|114799611|ref|YP_761506.1| 30S ribosomal protein S11 [Hyphomonas neptunium ATCC 15444]
 gi|123322952|sp|Q0BYD7|RS11_HYPNA RecName: Full=30S ribosomal protein S11
 gi|114739785|gb|ABI77910.1| ribosomal protein S11 [Hyphomonas neptunium ATCC 15444]
          Length = 129

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 76/129 (58%), Positives = 99/129 (76%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  +RIR RERKNI SG  HV S+FNNT +TITD  GNTI+WSS  V+ F GSRK++P
Sbjct: 1   MAREATRIRRRERKNITSGIVHVNSSFNNTMVTITDAQGNTISWSSSGVMNFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D + KA+ HG+ ++EV+V G G+GR+SALRAL+A G T+ +I D T I HNG
Sbjct: 61  YAAQMAAEDAAKKAKEHGLQTVEVRVRGPGSGRESALRALQAAGLTVTAINDTTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|52426080|ref|YP_089217.1| 30S ribosomal protein S11 [Mannheimia succiniciproducens MBEL55E]
 gi|59798653|sp|Q65QX8|RS11_MANSM RecName: Full=30S ribosomal protein S11
 gi|52308132|gb|AAU38632.1| RpsK protein [Mannheimia succiniciproducens MBEL55E]
          Length = 129

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 90/129 (69%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R +K +V G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKTPVRARKRVKKQVVDGVAHIHASFNNTIVTITDRQGNALAWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   +  G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEAVKEFGLKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|152978164|ref|YP_001343793.1| 30S ribosomal protein S11 [Actinobacillus succinogenes 130Z]
 gi|171704197|sp|A6VLL1|RS11_ACTSZ RecName: Full=30S ribosomal protein S11
 gi|150839887|gb|ABR73858.1| ribosomal protein S11 [Actinobacillus succinogenes 130Z]
 gi|330432101|gb|AEC17160.1| 30S ribosomal protein S11 [Gallibacterium anatis UMN179]
          Length = 129

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 90/129 (69%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R +K +V G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKTPVRARKRVKKQVVDGVAHIHASFNNTIVTITDRQGNALAWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   +  G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEMVKEFGLKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|158520748|ref|YP_001528618.1| ribosomal protein S11 [Desulfococcus oleovorans Hxd3]
 gi|226708359|sp|A8ZV80|RS11_DESOH RecName: Full=30S ribosomal protein S11
 gi|158509574|gb|ABW66541.1| ribosomal protein S11 [Desulfococcus oleovorans Hxd3]
          Length = 128

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 88/123 (71%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           + + + RKNI SG  H+ STFNNT +T+TD  GN I+WSS    GF GSRK++PFAAQ+A
Sbjct: 6   QTKKKVRKNIASGVVHIQSTFNNTIVTVTDVAGNVISWSSAGGRGFKGSRKSTPFAAQMA 65

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
           ++D   KA   G+ ++EV V G G GR+SALRAL+A G T+  I DVT I HNGCRP KR
Sbjct: 66  SEDAVKKAMAQGLQTVEVYVKGPGPGRESALRALQAAGLTVTMIRDVTPIPHNGCRPPKR 125

Query: 127 RRI 129
           RR+
Sbjct: 126 RRV 128


>gi|56961958|ref|YP_173680.1| 30S ribosomal protein S11 [Bacillus clausii KSM-K16]
 gi|59798607|sp|Q5WLN6|RS11_BACSK RecName: Full=30S ribosomal protein S11
 gi|56908192|dbj|BAD62719.1| 30S ribosomal protein S11 [Bacillus clausii KSM-K16]
          Length = 133

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/127 (55%), Positives = 96/127 (75%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K+ +R + R+RKNI SG AH+ STFNNT +TITDPHGN I+W+S   +GF GSRK++PFA
Sbjct: 7   KTNTRPKRRQRKNIDSGVAHIRSTFNNTIVTITDPHGNAISWASAGALGFKGSRKSTPFA 66

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  +  A  HGM ++EV V G GAGR++A+R+L+A+G  +  I DVT + HNGCR
Sbjct: 67  AQMAAESAAKTAMEHGMKTIEVSVKGPGAGREAAIRSLQAVGLEVNMIKDVTPVPHNGCR 126

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 127 PPKRRRV 133


>gi|220935469|ref|YP_002514368.1| 30S ribosomal protein S11 [Thioalkalivibrio sp. HL-EbGR7]
 gi|254811054|sp|B8GV35|RS11_THISH RecName: Full=30S ribosomal protein S11
 gi|219996779|gb|ACL73381.1| 30S ribosomal protein S11 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 129

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 92/129 (71%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M ++P+R R + +K +  G AH+ +TFNNT +TITD  GNT++W++    GF GSRK++P
Sbjct: 1   MAQAPTRTRKKVKKTVSDGIAHIYATFNNTIVTITDRQGNTLSWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     AQ +G+ +LEV V G G GR+SA+RAL   GF I++I D+T I HNG
Sbjct: 61  FAAQVAAERAGTAAQEYGLKNLEVLVRGPGPGRESAVRALNNAGFKILNISDITPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|320540588|ref|ZP_08040238.1| 30S ribosomal subunit protein S11 [Serratia symbiotica str. Tucson]
 gi|320029519|gb|EFW11548.1| 30S ribosomal subunit protein S11 [Serratia symbiotica str. Tucson]
          Length = 129

 Score =  141 bits (356), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R RK +  G AHV ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPVRTRKRVRKQVSDGVAHVYASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|164686552|ref|ZP_02210580.1| hypothetical protein CLOBAR_00119 [Clostridium bartlettii DSM
           16795]
 gi|164604421|gb|EDQ97886.1| hypothetical protein CLOBAR_00119 [Clostridium bartlettii DSM
           16795]
          Length = 132

 Score =  141 bits (356), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 93/127 (73%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K  +R+R RERKNI  G AH+ STFNNT +T+TD HGN I+W+S   +GF GSRK++PFA
Sbjct: 6   KKATRVRRRERKNIDRGHAHIQSTFNNTIVTLTDVHGNAISWASSGQLGFKGSRKSTPFA 65

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           +Q+A +  +  A  HG+ S+EV V G G+GR++A+RAL+A G  +  I DVT I HNGCR
Sbjct: 66  SQMAAETAAKAAMEHGLKSVEVFVKGPGSGREAAIRALQATGLEVTMIKDVTPIPHNGCR 125

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 126 PPKRRRV 132


>gi|59710867|ref|YP_203643.1| 30S ribosomal protein S11 [Vibrio fischeri ES114]
 gi|197334125|ref|YP_002155019.1| 30S ribosomal protein S11 [Vibrio fischeri MJ11]
 gi|209693946|ref|YP_002261874.1| 30S ribosomal protein S11 [Aliivibrio salmonicida LFI1238]
 gi|269104035|ref|ZP_06156732.1| SSU ribosomal protein S11p (S14e) [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|75354724|sp|Q5E891|RS11_VIBF1 RecName: Full=30S ribosomal protein S11
 gi|226708323|sp|B6EPU7|RS11_ALISL RecName: Full=30S ribosomal protein S11
 gi|226708432|sp|B5FGD9|RS11_VIBFM RecName: Full=30S ribosomal protein S11
 gi|59478968|gb|AAW84755.1| 30S ribosomal subunit protein S11 [Vibrio fischeri ES114]
 gi|197315615|gb|ACH65062.1| 30S ribosomal protein S11 [Vibrio fischeri MJ11]
 gi|208007897|emb|CAQ78027.1| 30S ribosomal protein S11 [Aliivibrio salmonicida LFI1238]
 gi|268163933|gb|EEZ42429.1| SSU ribosomal protein S11p (S14e) [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 129

 Score =  141 bits (356), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K P+R R R RK +  G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKQPTRARKRVRKQVADGVAHIHASFNNTIVTITDRQGNALAWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C   A+ +G+ +LEV V G G GR+S +RAL A G+ I +I D T I HNG
Sbjct: 61  FAAQVAAERCGEMAKEYGVKNLEVMVKGPGPGRESTIRALNAAGYRITNIVDATPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|113460231|ref|YP_718289.1| 30S ribosomal protein S11 [Haemophilus somnus 129PT]
 gi|123327086|sp|Q0I139|RS11_HAES1 RecName: Full=30S ribosomal protein S11
 gi|112822274|gb|ABI24363.1| SSU ribosomal protein S11P [Haemophilus somnus 129PT]
          Length = 129

 Score =  141 bits (356), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 90/129 (69%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R +K +V G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKTPVRTRKRVKKQVVDGVAHIHASFNNTIVTITDRQGNALAWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   +  G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEVVKEFGLKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|15603257|ref|NP_246331.1| 30S ribosomal protein S11 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|170718272|ref|YP_001785290.1| 30S ribosomal protein S11 [Haemophilus somnus 2336]
 gi|251793849|ref|YP_003008581.1| 30S ribosomal protein S11 [Aggregatibacter aphrophilus NJ8700]
 gi|260914658|ref|ZP_05921124.1| 30S ribosomal protein S11 [Pasteurella dagmatis ATCC 43325]
 gi|315633477|ref|ZP_07888767.1| 30S ribosomal protein S11 [Aggregatibacter segnis ATCC 33393]
 gi|48474634|sp|Q9CL52|RS11_PASMU RecName: Full=30S ribosomal protein S11
 gi|189040418|sp|B0UX37|RS11_HAES2 RecName: Full=30S ribosomal protein S11
 gi|12721767|gb|AAK03476.1| RpS11 [Pasteurella multocida subsp. multocida str. Pm70]
 gi|168826401|gb|ACA31772.1| ribosomal protein S11 [Haemophilus somnus 2336]
 gi|247535248|gb|ACS98494.1| ribosomal protein S11 [Aggregatibacter aphrophilus NJ8700]
 gi|260631257|gb|EEX49442.1| 30S ribosomal protein S11 [Pasteurella dagmatis ATCC 43325]
 gi|315477519|gb|EFU68261.1| 30S ribosomal protein S11 [Aggregatibacter segnis ATCC 33393]
          Length = 129

 Score =  141 bits (356), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 90/129 (69%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R +K +V G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKTPVRARKRVKKQVVDGVAHIHASFNNTIVTITDRQGNALAWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   +  G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEVVKEFGLKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|221133738|ref|ZP_03560043.1| 30S ribosomal protein S11 [Glaciecola sp. HTCC2999]
          Length = 129

 Score =  141 bits (356), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 91/129 (70%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P+R + R ++ +  G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKAPTRAKKRAKRQVADGMAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     AQ +G+ +LEV V G G GR+SA+RAL A G+ I +I DVT I HNG
Sbjct: 61  FAAQVAAERAGEAAQEYGLKNLEVFVKGPGPGRESAIRALNATGYKITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|261867277|ref|YP_003255199.1| 30S ribosomal protein S11 [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412609|gb|ACX81980.1| 30S ribosomal protein S11 [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 129

 Score =  141 bits (355), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 90/129 (69%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R +K +V G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKTPVRARKRVKKQVVDGVAHIHASFNNTIVTITDRQGNVLAWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   +  G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEIVKEFGLKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|68249396|ref|YP_248508.1| 30S ribosomal protein S11 [Haemophilus influenzae 86-028NP]
 gi|145628305|ref|ZP_01784106.1| 30S ribosomal protein S11 [Haemophilus influenzae 22.1-21]
 gi|145630547|ref|ZP_01786327.1| 30S ribosomal protein S11 [Haemophilus influenzae R3021]
 gi|145632159|ref|ZP_01787894.1| 30S ribosomal protein S11 [Haemophilus influenzae 3655]
 gi|145634788|ref|ZP_01790496.1| 30S ribosomal protein S11 [Haemophilus influenzae PittAA]
 gi|145636641|ref|ZP_01792308.1| 30S ribosomal protein S11 [Haemophilus influenzae PittHH]
 gi|145638398|ref|ZP_01794008.1| 30S ribosomal protein S11 [Haemophilus influenzae PittII]
 gi|148826555|ref|YP_001291308.1| 30S ribosomal protein S11 [Haemophilus influenzae PittEE]
 gi|229844668|ref|ZP_04464807.1| 30S ribosomal protein S11 [Haemophilus influenzae 6P18H1]
 gi|229845851|ref|ZP_04465963.1| 30S ribosomal protein S11 [Haemophilus influenzae 7P49H1]
 gi|260579892|ref|ZP_05847722.1| 30S ribosomal protein S11 [Haemophilus influenzae RdAW]
 gi|260581617|ref|ZP_05849414.1| 30S ribosomal protein S11 [Haemophilus influenzae NT127]
 gi|293390662|ref|ZP_06634996.1| 30S ribosomal protein S11 [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|319775265|ref|YP_004137753.1| 30S ribosomal subunit protein S11 [Haemophilus influenzae F3047]
 gi|319897705|ref|YP_004135902.1| 30S ribosomal subunit protein s11 [Haemophilus influenzae F3031]
 gi|325577149|ref|ZP_08147633.1| 30S ribosomal protein S11 [Haemophilus parainfluenzae ATCC 33392]
 gi|329122806|ref|ZP_08251378.1| 30S ribosomal protein S11 [Haemophilus aegyptius ATCC 11116]
 gi|81336177|sp|Q4QM99|RS11_HAEI8 RecName: Full=30S ribosomal protein S11
 gi|166231814|sp|A5UDS4|RS11_HAEIE RecName: Full=30S ribosomal protein S11
 gi|68057595|gb|AAX87848.1| 30S ribosomal protein S11 [Haemophilus influenzae 86-028NP]
 gi|144980080|gb|EDJ89739.1| 30S ribosomal protein S11 [Haemophilus influenzae 22.1-21]
 gi|144983937|gb|EDJ91379.1| 30S ribosomal protein S11 [Haemophilus influenzae R3021]
 gi|144987066|gb|EDJ93596.1| 30S ribosomal protein S11 [Haemophilus influenzae 3655]
 gi|145267954|gb|EDK07950.1| 30S ribosomal protein S11 [Haemophilus influenzae PittAA]
 gi|145270167|gb|EDK10103.1| 30S ribosomal protein S11 [Haemophilus influenzae PittHH]
 gi|145272727|gb|EDK12634.1| 30S ribosomal protein S11 [Haemophilus influenzae PittII]
 gi|148716715|gb|ABQ98925.1| 30S ribosomal protein S11 [Haemophilus influenzae PittEE]
 gi|229810855|gb|EEP46572.1| 30S ribosomal protein S11 [Haemophilus influenzae 7P49H1]
 gi|229812382|gb|EEP48072.1| 30S ribosomal protein S11 [Haemophilus influenzae 6P18H1]
 gi|260093176|gb|EEW77109.1| 30S ribosomal protein S11 [Haemophilus influenzae RdAW]
 gi|260095210|gb|EEW79101.1| 30S ribosomal protein S11 [Haemophilus influenzae NT127]
 gi|290951196|gb|EFE01315.1| 30S ribosomal protein S11 [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|301155353|emb|CBW14819.1| 30S ribosomal subunit protein S11 [Haemophilus parainfluenzae T3T1]
 gi|301169519|emb|CBW29120.1| 30S ribosomal subunit protein S11 [Haemophilus influenzae 10810]
 gi|309751538|gb|ADO81522.1| 30S ribosomal protein S11 [Haemophilus influenzae R2866]
 gi|309973708|gb|ADO96909.1| 30S ribosomal protein S11 [Haemophilus influenzae R2846]
 gi|317433211|emb|CBY81586.1| 30S ribosomal subunit protein S11 [Haemophilus influenzae F3031]
 gi|317449856|emb|CBY86067.1| 30S ribosomal subunit protein S11 [Haemophilus influenzae F3047]
 gi|325160731|gb|EGC72852.1| 30S ribosomal protein S11 [Haemophilus parainfluenzae ATCC 33392]
 gi|327472070|gb|EGF17508.1| 30S ribosomal protein S11 [Haemophilus aegyptius ATCC 11116]
          Length = 129

 Score =  141 bits (355), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 90/129 (69%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R +K +V G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKTPVRARKRVKKQVVDGVAHIHASFNNTIVTITDRQGNALAWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   +  G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEIVKEFGLKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|54307564|ref|YP_128584.1| 30S ribosomal protein S11 [Photobacterium profundum SS9]
 gi|89076301|ref|ZP_01162642.1| 30S ribosomal protein S11 [Photobacterium sp. SKA34]
 gi|90414979|ref|ZP_01222941.1| 30S ribosomal protein S11 [Photobacterium profundum 3TCK]
 gi|90581701|ref|ZP_01237489.1| 30S ribosomal protein S11 [Vibrio angustum S14]
 gi|330447014|ref|ZP_08310664.1| 30S ribosomal subunit protein S11 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|59798727|sp|Q6LV93|RS11_PHOPR RecName: Full=30S ribosomal protein S11
 gi|46911984|emb|CAG18782.1| putative ribosomal protein S11 [Photobacterium profundum SS9]
 gi|89048005|gb|EAR53594.1| 30S ribosomal protein S11 [Photobacterium sp. SKA34]
 gi|90323918|gb|EAS40518.1| 30S ribosomal protein S11 [Photobacterium profundum 3TCK]
 gi|90437116|gb|EAS62319.1| 30S ribosomal protein S11 [Vibrio angustum S14]
 gi|328491205|dbj|GAA05161.1| 30S ribosomal subunit protein S11 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 129

 Score =  141 bits (355), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K P+R R R RK +  G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKQPTRARKRVRKQVADGVAHIHASFNNTIVTITDRQGNALSWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C   A+ +G+ +LEV V G G GR+S +RAL A GF I +I D T I HNG
Sbjct: 61  FAAQVAAERCGEMAKEYGVKNLEVMVKGPGPGRESTIRALNAAGFRITNIVDATPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|33152931|ref|NP_874284.1| 30S ribosomal protein S11 [Haemophilus ducreyi 35000HP]
 gi|46143636|ref|ZP_00134834.2| COG0100: Ribosomal protein S11 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|126209246|ref|YP_001054471.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae L20]
 gi|165977219|ref|YP_001652812.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|190151137|ref|YP_001969662.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|303250035|ref|ZP_07336237.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|303253209|ref|ZP_07339358.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|307246712|ref|ZP_07528782.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|307248853|ref|ZP_07530866.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|307251081|ref|ZP_07533005.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|307253467|ref|ZP_07535338.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307255697|ref|ZP_07537501.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|307260149|ref|ZP_07541859.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|307262277|ref|ZP_07543926.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|307264486|ref|ZP_07546071.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|59798858|sp|Q7VKF6|RS11_HAEDU RecName: Full=30S ribosomal protein S11
 gi|152060568|sp|A3N380|RS11_ACTP2 RecName: Full=30S ribosomal protein S11
 gi|226708321|sp|B3GZ34|RS11_ACTP7 RecName: Full=30S ribosomal protein S11
 gi|226708322|sp|B0BSV4|RS11_ACTPJ RecName: Full=30S ribosomal protein S11
 gi|33149156|gb|AAP96673.1| 30S ribosomal protein S11 [Haemophilus ducreyi 35000HP]
 gi|126098038|gb|ABN74866.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|165877320|gb|ABY70368.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|189916268|gb|ACE62520.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|302647891|gb|EFL78098.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|302651098|gb|EFL81252.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306852412|gb|EFM84647.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|306854780|gb|EFM86970.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|306856911|gb|EFM89043.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|306859146|gb|EFM91188.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306861374|gb|EFM93364.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|306865795|gb|EFM97673.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306868040|gb|EFM99867.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306870183|gb|EFN01942.1| 30S ribosomal protein S11 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
          Length = 129

 Score =  141 bits (355), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R +K I  G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKTPVRARKRVKKQIADGVAHIHASFNNTIVTITDRQGNALAWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   +  G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEAVKEFGLKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|326803057|ref|YP_004320875.1| 30S ribosomal protein S11 [Aerococcus urinae ACS-120-V-Col10a]
 gi|326650602|gb|AEA00785.1| 30S ribosomal protein S11 [Aerococcus urinae ACS-120-V-Col10a]
          Length = 131

 Score =  141 bits (355), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +K++ SG AH+ STFNNT + ITD  GN I+WSS   +GF GSRK++P+AAQ+A++
Sbjct: 11  KRRVKKHVESGVAHIHSTFNNTIVMITDEQGNAISWSSAGALGFKGSRKSTPYAAQLASE 70

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A +HGM ++EV V G G+GR+SA+RAL+A G  + +I DVT I HNGCRP KRRR
Sbjct: 71  TAAKTAMDHGMKTVEVSVKGPGSGRESAIRALQAAGLEVTAIRDVTPIPHNGCRPPKRRR 130

Query: 129 I 129
           +
Sbjct: 131 V 131


>gi|295698628|ref|YP_003603283.1| ribosomal protein S11 [Candidatus Riesia pediculicola USDA]
 gi|291157490|gb|ADD79935.1| ribosomal protein S11 [Candidatus Riesia pediculicola USDA]
          Length = 147

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 68/131 (51%), Positives = 94/131 (71%), Gaps = 2/131 (1%)

Query: 1   MPKSPSRIRNRE--RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKN 58
           + K  + IRN+   RK ++ G AH+ ++FNNT +TITD  GNT+AW++    GF GSRK+
Sbjct: 17  LKKMKNSIRNKRKIRKQVLDGIAHIHASFNNTIVTITDRKGNTLAWATSGGSGFRGSRKS 76

Query: 59  SPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAH 118
           +PFAAQ+AT+ CS   + +G+ +LEV V G G GR+SA+R L A+GF I +I DVT I H
Sbjct: 77  TPFAAQIATERCSESVKEYGVKNLEVMVKGPGPGRESAIRTLHAVGFQITNIIDVTPIPH 136

Query: 119 NGCRPRKRRRI 129
           NGCRP K+RR+
Sbjct: 137 NGCRPPKKRRV 147


>gi|188535255|ref|YP_001909052.1| 30S ribosomal protein S11 [Erwinia tasmaniensis Et1/99]
 gi|259909977|ref|YP_002650333.1| 30S ribosomal protein S11 [Erwinia pyrifoliae Ep1/96]
 gi|291619152|ref|YP_003521894.1| RpsK [Pantoea ananatis LMG 20103]
 gi|292489826|ref|YP_003532716.1| 30S ribosomal protein S11 [Erwinia amylovora CFBP1430]
 gi|292900868|ref|YP_003540237.1| 30S ribosomal protein S11 [Erwinia amylovora ATCC 49946]
 gi|300718682|ref|YP_003743485.1| 30S ribosomal protein S11 [Erwinia billingiae Eb661]
 gi|304399267|ref|ZP_07381133.1| 30S ribosomal protein S11 [Pantoea sp. aB]
 gi|308188333|ref|YP_003932464.1| 30S ribosomal protein S11 [Pantoea vagans C9-1]
 gi|317049817|ref|YP_004117465.1| 30S ribosomal protein S11 [Pantoea sp. At-9b]
 gi|329298511|ref|ZP_08255847.1| 30S ribosomal protein S11 [Plautia stali symbiont]
 gi|226708371|sp|B2VK73|RS11_ERWT9 RecName: Full=30S ribosomal protein S11
 gi|188030297|emb|CAO98186.1| 30S ribosomal protein S11 [Erwinia tasmaniensis Et1/99]
 gi|224965599|emb|CAX57131.1| 30S ribosomal protein S11 [Erwinia pyrifoliae Ep1/96]
 gi|291154182|gb|ADD78766.1| RpsK [Pantoea ananatis LMG 20103]
 gi|291200716|emb|CBJ47849.1| 30S ribosomal subunit protein S11 [Erwinia amylovora ATCC 49946]
 gi|291555263|emb|CBA23543.1| 30S ribosomal protein S11 [Erwinia amylovora CFBP1430]
 gi|299064518|emb|CAX61638.1| 30S ribosomal protein S11 [Erwinia billingiae Eb661]
 gi|304353193|gb|EFM17574.1| 30S ribosomal protein S11 [Pantoea sp. aB]
 gi|308058843|gb|ADO11015.1| 30S ribosomal protein S11 [Pantoea vagans C9-1]
 gi|310765575|gb|ADP10525.1| 30S ribosomal protein S11 [Erwinia sp. Ejp617]
 gi|312174008|emb|CBX82261.1| 30S ribosomal protein S11 [Erwinia amylovora ATCC BAA-2158]
 gi|316951434|gb|ADU70909.1| 30S ribosomal protein S11 [Pantoea sp. At-9b]
 gi|327395481|dbj|BAK12903.1| 30S ribosomal protein S11 RpsK [Pantoea ananatis AJ13355]
          Length = 129

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 90/129 (69%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R RK +  G AHV ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPVRARKRVRKQVSDGVAHVHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   +++G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEAVKDYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|223042026|ref|ZP_03612207.1| 30S ribosomal protein S11 [Actinobacillus minor 202]
 gi|240948152|ref|ZP_04752555.1| 30S ribosomal protein S11 [Actinobacillus minor NM305]
 gi|254362774|ref|ZP_04978856.1| ribosomal protein S11 [Mannheimia haemolytica PHL213]
 gi|261492715|ref|ZP_05989263.1| ribosomal protein S11 [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261495670|ref|ZP_05992116.1| ribosomal protein S11 [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|153094403|gb|EDN75252.1| ribosomal protein S11 [Mannheimia haemolytica PHL213]
 gi|223017188|gb|EEF15619.1| 30S ribosomal protein S11 [Actinobacillus minor 202]
 gi|240297505|gb|EER48012.1| 30S ribosomal protein S11 [Actinobacillus minor NM305]
 gi|261308777|gb|EEY10034.1| ribosomal protein S11 [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261311568|gb|EEY12723.1| ribosomal protein S11 [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 129

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R +K I  G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKTPVRARKRVKKQIADGVAHIHASFNNTIVTITDRQGNALAWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   +  G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEMVKEFGLKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|170728986|ref|YP_001763012.1| 30S ribosomal protein S11 [Shewanella woodyi ATCC 51908]
 gi|294142910|ref|YP_003558888.1| 30S ribosomal protein S11 [Shewanella violacea DSS12]
 gi|226708416|sp|B1KMW0|RS11_SHEWM RecName: Full=30S ribosomal protein S11
 gi|302393752|sp|Q9S0R0|RS11_SHEVD RecName: Full=30S ribosomal protein S11
 gi|169814333|gb|ACA88917.1| ribosomal protein S11 [Shewanella woodyi ATCC 51908]
 gi|293329379|dbj|BAJ04110.1| ribosomal protein S11 [Shewanella violacea DSS12]
          Length = 130

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 70/130 (53%), Positives = 93/130 (71%), Gaps = 1/130 (0%)

Query: 1   MPKSPSR-IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           M KSPSR  R R RK +  G AH+ ++FNNT ITITD  GN ++W++    GF GSRK++
Sbjct: 1   MAKSPSRSPRKRVRKQVADGMAHIHASFNNTIITITDRQGNALSWATSGGSGFRGSRKST 60

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           PFAAQVA +     AQ++G+ +LEV V G G GR+SA+RAL ++G+ I +I DVT I HN
Sbjct: 61  PFAAQVAAERAGVAAQDYGVKNLEVFVKGPGPGRESAIRALNSVGYKITNITDVTPIPHN 120

Query: 120 GCRPRKRRRI 129
           GCRP K+RR+
Sbjct: 121 GCRPPKKRRV 130


>gi|127511115|ref|YP_001092312.1| 30S ribosomal protein S11 [Shewanella loihica PV-4]
 gi|152060820|sp|A3Q9A5|RS11_SHELP RecName: Full=30S ribosomal protein S11
 gi|126636410|gb|ABO22053.1| SSU ribosomal protein S11P [Shewanella loihica PV-4]
          Length = 130

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 70/130 (53%), Positives = 92/130 (70%), Gaps = 1/130 (0%)

Query: 1   MPKSPSR-IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           M K PSR  R R RK +  G AH+ ++FNNT ITITD  GN ++W++    GF GSRK++
Sbjct: 1   MAKVPSRSTRKRVRKQVADGMAHIHASFNNTIITITDRQGNALSWATSGGSGFRGSRKST 60

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           PFAAQVA +     AQ++G+ +LEV V G G GR+SA+RAL A+G+ I +I DVT I HN
Sbjct: 61  PFAAQVAAERAGVAAQDYGVKNLEVFVKGPGPGRESAIRALNAVGYKITNITDVTPIPHN 120

Query: 120 GCRPRKRRRI 129
           GCRP K+RR+
Sbjct: 121 GCRPPKKRRV 130


>gi|218779738|ref|YP_002431056.1| ribosomal protein S11 [Desulfatibacillum alkenivorans AK-01]
 gi|226708358|sp|B8FER1|RS11_DESAA RecName: Full=30S ribosomal protein S11
 gi|218761122|gb|ACL03588.1| ribosomal protein S11 [Desulfatibacillum alkenivorans AK-01]
          Length = 128

 Score =  140 bits (354), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 72/121 (59%), Positives = 93/121 (76%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R R++KNI SG AH+ +TFNNT +TITDP G  ++WSS  VVGF GSRK++PFAAQ+A +
Sbjct: 8   RKRDKKNIPSGVAHIQATFNNTIVTITDPSGAVVSWSSAGVVGFKGSRKSTPFAAQLAAE 67

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           D + KA  HGM ++EV V G G+GR+SALRAL+  G  +V + DVT + HNGCRPRKRRR
Sbjct: 68  DAAKKAMEHGMRNVEVYVKGPGSGRESALRALQGAGLNVVMLRDVTPVPHNGCRPRKRRR 127

Query: 129 I 129
           +
Sbjct: 128 V 128


>gi|319893175|ref|YP_004150050.1| SSU ribosomal protein S11p (S14e) [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317162871|gb|ADV06414.1| SSU ribosomal protein S11p (S14e) [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323463777|gb|ADX75930.1| ribosomal protein S11 [Staphylococcus pseudintermedius ED99]
          Length = 129

 Score =  140 bits (353), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT +TITD  GN ++WSS   +GF GS+K++PFAAQ+A++
Sbjct: 9   KRRVKKNIENGVAHIRSTFNNTIVTITDEFGNALSWSSAGALGFKGSKKSTPFAAQMASE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             S  A  HG+ S+EV V G G GR+SA+RAL++ G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TASKAAMEHGLKSVEVTVKGPGPGRESAIRALQSAGLEVTAIKDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|238021613|ref|ZP_04602039.1| hypothetical protein GCWU000324_01513 [Kingella oralis ATCC 51147]
 gi|237866227|gb|EEP67269.1| hypothetical protein GCWU000324_01513 [Kingella oralis ATCC 51147]
          Length = 131

 Score =  140 bits (353), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 89/124 (71%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           SR+R + RK +  G  HV ++FNNT ITITD  GN ++W++    GF GSRK++PFAAQV
Sbjct: 8   SRVRKKVRKTVSEGIVHVHASFNNTIITITDRQGNALSWATSGGAGFKGSRKSTPFAAQV 67

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +     AQ +G+ +LEV++ G G GR+S++RAL A+GF I SI DVT + HNGCRP K
Sbjct: 68  AAESAGKVAQEYGVKNLEVRIKGPGPGRESSVRALNALGFKITSITDVTPLPHNGCRPSK 127

Query: 126 RRRI 129
           +RRI
Sbjct: 128 KRRI 131


>gi|119773377|ref|YP_926117.1| 30S ribosomal protein S11 [Shewanella amazonensis SB2B]
 gi|152060819|sp|A1S241|RS11_SHEAM RecName: Full=30S ribosomal protein S11
 gi|119765877|gb|ABL98447.1| SSU ribosomal protein S11P [Shewanella amazonensis SB2B]
          Length = 130

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 92/130 (70%), Gaps = 1/130 (0%)

Query: 1   MPKSPSR-IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           M K PSR  R R RK +  G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++
Sbjct: 1   MAKVPSRSPRKRVRKQVADGMAHIHASFNNTIVTITDRQGNALSWATAGGSGFRGSRKST 60

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           PFAAQVA +     AQ++G+ +LEV V G G GR+SA+RAL A+G+ I +I DVT I HN
Sbjct: 61  PFAAQVAAERAGVAAQDYGLKNLEVFVKGPGPGRESAIRALNAVGYKITNITDVTPIPHN 120

Query: 120 GCRPRKRRRI 129
           GCRP K+RR+
Sbjct: 121 GCRPPKKRRV 130


>gi|147676681|ref|YP_001210896.1| 30S ribosomal protein S11 [Pelotomaculum thermopropionicum SI]
 gi|189040424|sp|A5D5E6|RS11_PELTS RecName: Full=30S ribosomal protein S11
 gi|146272778|dbj|BAF58527.1| ribosomal protein S11 [Pelotomaculum thermopropionicum SI]
          Length = 129

 Score =  140 bits (352), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 95/129 (73%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  +R + RERKNIVSG AH+ STFNNT +TITD  GNTI+WSS   VGF GSRK++P
Sbjct: 1   MARRVTRAKKRERKNIVSGVAHIKSTFNNTIVTITDTKGNTISWSSAGQVGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  + +A  HG+  +EV V G GAGR++A+R+L+A G  +  I DVT I HNG
Sbjct: 61  FAAQMAAESAAREAMEHGLKEVEVMVKGPGAGREAAIRSLQAAGLEVNLIKDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|317494319|ref|ZP_07952733.1| 30S ribosomal protein S11 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917569|gb|EFV38914.1| 30S ribosomal protein S11 [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 129

 Score =  140 bits (352), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R RK +  G AHV ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPIRARKRVRKQVSDGVAHVHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|293393289|ref|ZP_06637603.1| 30S ribosomal protein S11 [Serratia odorifera DSM 4582]
 gi|291424199|gb|EFE97414.1| 30S ribosomal protein S11 [Serratia odorifera DSM 4582]
          Length = 129

 Score =  140 bits (352), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPVRTRKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|157372754|ref|YP_001480743.1| 30S ribosomal protein S11 [Serratia proteamaculans 568]
 gi|270264350|ref|ZP_06192616.1| 30S ribosomal protein S11 [Serratia odorifera 4Rx13]
 gi|166991582|sp|A8GKH5|RS11_SERP5 RecName: Full=30S ribosomal protein S11
 gi|157324518|gb|ABV43615.1| ribosomal protein S11 [Serratia proteamaculans 568]
 gi|270041486|gb|EFA14584.1| 30S ribosomal protein S11 [Serratia odorifera 4Rx13]
          Length = 129

 Score =  140 bits (352), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R RK +  G AHV ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPVRTRKRVRKQVSDGVAHVHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|71278557|ref|YP_267374.1| 30S ribosomal protein S11 [Colwellia psychrerythraea 34H]
 gi|91207738|sp|Q488Z0|RS11_COLP3 RecName: Full=30S ribosomal protein S11
 gi|71144297|gb|AAZ24770.1| ribosomal protein S11 [Colwellia psychrerythraea 34H]
          Length = 129

 Score =  140 bits (352), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 90/129 (69%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R +K +  G AH+ ++FNNT +T+TD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKTPVRTRKRVKKQVADGMAHIHASFNNTIVTLTDRQGNALSWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA D   A A+  G+ ++EV V G G GR+SA+RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAADRAGAVAKEFGLKNIEVFVKGPGPGRESAIRALNAAGFKITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|73661997|ref|YP_300778.1| 30S ribosomal protein S11 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|82581614|sp|Q49ZE3|RS11_STAS1 RecName: Full=30S ribosomal protein S11
 gi|72494512|dbj|BAE17833.1| 30S ribosomal protein S11 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 129

 Score =  140 bits (352), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT +TITD  GN ++WSS   +GF GS+K++PFAAQ+A++
Sbjct: 9   KRRVKKNIENGVAHIRSTFNNTIVTITDEFGNALSWSSAGALGFKGSKKSTPFAAQMASE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             S  A  HG+ S+EV V G G GR+SA+RAL++ G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TASKTAMEHGLKSVEVTVKGPGPGRESAIRALQSAGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|71891997|ref|YP_277727.1| 30S ribosomal protein S11 [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
 gi|91207731|sp|Q493I6|RS11_BLOPB RecName: Full=30S ribosomal protein S11
 gi|71796103|gb|AAZ40854.1| 30S ribosomal subunit protein S11 [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 130

 Score =  140 bits (352), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 88/123 (71%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R R R +K I+ G AH+ ++FNNT ITI+D  GNT+ W++    GF GSRK++PFAAQ+A
Sbjct: 8   RARKRLKKQILDGVAHIHASFNNTIITISDKQGNTLGWATAGGSGFRGSRKSTPFAAQIA 67

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            + C+   Q +G+ +LEV V G G GR+SA+RAL A GF I SI DVT I HNGCRP K+
Sbjct: 68  AERCAEIVQEYGVKNLEVMVKGPGPGRESAVRALNAAGFHITSITDVTPIPHNGCRPSKK 127

Query: 127 RRI 129
           RR+
Sbjct: 128 RRV 130


>gi|261346912|ref|ZP_05974556.1| 30S ribosomal protein S11 [Providencia rustigianii DSM 4541]
 gi|288933289|ref|YP_003437348.1| 30S ribosomal protein S11 [Klebsiella variicola At-22]
 gi|290512091|ref|ZP_06551459.1| 30S ribosomal protein S11 [Klebsiella sp. 1_1_55]
 gi|282564978|gb|EFB70513.1| 30S ribosomal protein S11 [Providencia rustigianii DSM 4541]
 gi|288888018|gb|ADC56336.1| 30S ribosomal protein S11 [Klebsiella variicola At-22]
 gi|289775881|gb|EFD83881.1| 30S ribosomal protein S11 [Klebsiella sp. 1_1_55]
          Length = 129

 Score =  140 bits (352), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPVRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|224827040|ref|ZP_03700137.1| ribosomal protein S11 [Lutiella nitroferrum 2002]
 gi|224600706|gb|EEG06892.1| ribosomal protein S11 [Lutiella nitroferrum 2002]
          Length = 131

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 66/123 (53%), Positives = 89/123 (72%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R+R + RK++  G  HV ++FNNT ITITD  GN ++W++    GF GSRK++PFAAQVA
Sbjct: 9   RVRKKVRKSVSEGIVHVHASFNNTIITITDRQGNALSWATSGGAGFKGSRKSTPFAAQVA 68

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +     AQ +G+ +LEV++ G G GR+SA+RAL A+GF I SI DVT + HNGCRP K+
Sbjct: 69  AEHAGKVAQEYGVKNLEVRIKGPGPGRESAVRALNALGFKITSISDVTPVPHNGCRPPKK 128

Query: 127 RRI 129
           RRI
Sbjct: 129 RRI 131


>gi|33519681|ref|NP_878513.1| 30S ribosomal protein S11 [Candidatus Blochmannia floridanus]
 gi|59798859|sp|Q7VQC5|RS11_BLOFL RecName: Full=30S ribosomal protein S11
 gi|33517344|emb|CAD83729.1| 30S ribosomal subunit protein S11 [Candidatus Blochmannia
           floridanus]
          Length = 130

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 93/130 (71%), Gaps = 1/130 (0%)

Query: 1   MPKSPS-RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           M KS S R+R R +K +  G AH+ ++FNNT +TI+D  GNT+ W++    GF GSRK++
Sbjct: 1   MIKSSSLRLRKRIKKQVTDGIAHIHASFNNTIVTISDRQGNTLGWATSGGSGFRGSRKST 60

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           PFAAQ+A + C+   Q +G+ +LEV V G G GR+SA+RAL A GF I+SI DVT I HN
Sbjct: 61  PFAAQIAAERCAEIVQEYGVKNLEVMVKGPGPGRESAVRALNAAGFHIISIIDVTPIPHN 120

Query: 120 GCRPRKRRRI 129
           GCRP K+RR+
Sbjct: 121 GCRPAKKRRV 130


>gi|239636208|ref|ZP_04677212.1| 30S ribosomal protein S11 [Staphylococcus warneri L37603]
 gi|239598224|gb|EEQ80717.1| 30S ribosomal protein S11 [Staphylococcus warneri L37603]
 gi|330685130|gb|EGG96794.1| 30S ribosomal protein S11 [Staphylococcus epidermidis VCU121]
          Length = 129

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 87/117 (74%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KNI SG AH+ STFNNT +TITD  GN ++WSS   +GF GS+K++PFAAQ+A++  S 
Sbjct: 13  KKNIESGVAHIRSTFNNTIVTITDEFGNALSWSSAGALGFKGSKKSTPFAAQMASETASK 72

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            A  HG+ ++EV V G G GR+SA+RAL++ G  + +I DVT + HNGCRP KRRR+
Sbjct: 73  TAMEHGLKTVEVTVKGPGPGRESAIRALQSAGLEVTAIRDVTPVPHNGCRPPKRRRV 129


>gi|91791562|ref|YP_561213.1| 30S ribosomal protein S11 [Shewanella denitrificans OS217]
 gi|122969075|sp|Q12ST6|RS11_SHEDO RecName: Full=30S ribosomal protein S11
 gi|91713564|gb|ABE53490.1| SSU ribosomal protein S11P [Shewanella denitrificans OS217]
          Length = 130

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 92/130 (70%), Gaps = 1/130 (0%)

Query: 1   MPKSPSR-IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           M K PSR  R R RK +  G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++
Sbjct: 1   MAKVPSRSPRKRVRKQVADGMAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKST 60

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           PFAAQVA +     AQ++G+ +LEV V G G GR+SA+RAL A+G+ I +I DVT I HN
Sbjct: 61  PFAAQVAAERAGIAAQDYGLKNLEVFVKGPGPGRESAIRALNAVGYKITNITDVTPIPHN 120

Query: 120 GCRPRKRRRI 129
           GCRP K+RR+
Sbjct: 121 GCRPPKKRRV 130


>gi|146313362|ref|YP_001178436.1| 30S ribosomal protein S11 [Enterobacter sp. 638]
 gi|166991579|sp|A4WFA5|RS11_ENT38 RecName: Full=30S ribosomal protein S11
 gi|145320238|gb|ABP62385.1| SSU ribosomal protein S11P [Enterobacter sp. 638]
 gi|295096940|emb|CBK86030.1| SSU ribosomal protein S11P [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 129

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPVRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEAVKEYGIKNLEVMVKGPGPGRESTVRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|37528521|ref|NP_931866.1| 30S ribosomal protein S11 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|50122928|ref|YP_052095.1| 30S ribosomal protein S11 [Pectobacterium atrosepticum SCRI1043]
 gi|152972205|ref|YP_001337351.1| 30S ribosomal protein S11 [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|183600729|ref|ZP_02962222.1| hypothetical protein PROSTU_04325 [Providencia stuartii ATCC 25827]
 gi|197287091|ref|YP_002152963.1| 30S ribosomal protein S11 [Proteus mirabilis HI4320]
 gi|226329503|ref|ZP_03805021.1| hypothetical protein PROPEN_03412 [Proteus penneri ATCC 35198]
 gi|227115249|ref|ZP_03828905.1| 30S ribosomal protein S11 [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227328926|ref|ZP_03832950.1| 30S ribosomal protein S11 [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
 gi|227354913|ref|ZP_03839327.1| ribosomal protein S11 [Proteus mirabilis ATCC 29906]
 gi|238896794|ref|YP_002921539.1| 30S ribosomal protein S11 [Klebsiella pneumoniae NTUH-K2044]
 gi|242237882|ref|YP_002986063.1| ribosomal protein S11 [Dickeya dadantii Ech703]
 gi|253690160|ref|YP_003019350.1| ribosomal protein S11 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|253991666|ref|YP_003043022.1| 30S ribosomal protein S11 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|261823209|ref|YP_003261315.1| 30S ribosomal protein S11 [Pectobacterium wasabiae WPP163]
 gi|268593564|ref|ZP_06127785.1| 30S ribosomal protein S11 [Providencia rettgeri DSM 1131]
 gi|271502223|ref|YP_003335249.1| 30S ribosomal protein S11 [Dickeya dadantii Ech586]
 gi|290477170|ref|YP_003470085.1| 30S ribosomal subunit protein S11 [Xenorhabdus bovienii SS-2004]
 gi|300721389|ref|YP_003710660.1| 30S ribosomal subunit protein S11 [Xenorhabdus nematophila ATCC
           19061]
 gi|307132816|ref|YP_003884832.1| 30S ribosomal subunit protein S11 [Dickeya dadantii 3937]
 gi|330002272|ref|ZP_08304266.1| 30S ribosomal protein S11 [Klebsiella sp. MS 92-3]
 gi|59798689|sp|Q6CZZ3|RS11_ERWCT RecName: Full=30S ribosomal protein S11
 gi|59798821|sp|Q7MYH3|RS11_PHOLL RecName: Full=30S ribosomal protein S11
 gi|166231817|sp|A6TEV0|RS11_KLEP7 RecName: Full=30S ribosomal protein S11
 gi|226708402|sp|B4F1K7|RS11_PROMH RecName: Full=30S ribosomal protein S11
 gi|259494630|sp|C6DFS5|RS11_PECCP RecName: Full=30S ribosomal protein S11
 gi|36787959|emb|CAE17076.1| 30S ribosomal protein S11 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|49613454|emb|CAG76905.1| 30S ribosomal subunit protein S11 [Pectobacterium atrosepticum
           SCRI1043]
 gi|150957054|gb|ABR79084.1| 30S ribosomal protein S11 [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|188019709|gb|EDU57749.1| hypothetical protein PROSTU_04325 [Providencia stuartii ATCC 25827]
 gi|194684578|emb|CAR46426.1| 30S ribosomal protein S11 [Proteus mirabilis HI4320]
 gi|225202689|gb|EEG85043.1| hypothetical protein PROPEN_03412 [Proteus penneri ATCC 35198]
 gi|227164995|gb|EEI49834.1| ribosomal protein S11 [Proteus mirabilis ATCC 29906]
 gi|238549121|dbj|BAH65472.1| 30S ribosomal protein S11 [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|242129939|gb|ACS84241.1| ribosomal protein S11 [Dickeya dadantii Ech703]
 gi|251756738|gb|ACT14814.1| ribosomal protein S11 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|253783116|emb|CAQ86281.1| 30s ribosomal subunit protein s11 [Photorhabdus asymbiotica]
 gi|261607222|gb|ACX89708.1| 30S ribosomal protein S11 [Pectobacterium wasabiae WPP163]
 gi|270345778|gb|ACZ78543.1| 30S ribosomal protein S11 [Dickeya dadantii Ech586]
 gi|284006140|emb|CBA71382.1| 30S ribosomal protein S11 [Arsenophonus nasoniae]
 gi|289176518|emb|CBJ83327.1| 30S ribosomal subunit protein S11 [Xenorhabdus bovienii SS-2004]
 gi|291310841|gb|EFE51294.1| 30S ribosomal protein S11 [Providencia rettgeri DSM 1131]
 gi|297627877|emb|CBJ88423.1| 30S ribosomal subunit protein S11 [Xenorhabdus nematophila ATCC
           19061]
 gi|306530345|gb|ADN00276.1| 30S ribosomal subunit protein S11 [Dickeya dadantii 3937]
 gi|328537345|gb|EGF63595.1| 30S ribosomal protein S11 [Klebsiella sp. MS 92-3]
          Length = 129

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|222150470|ref|YP_002559623.1| 30S ribosomal protein S11 [Macrococcus caseolyticus JCSC5402]
 gi|254811030|sp|B9E9L6|RS11_MACCJ RecName: Full=30S ribosomal protein S11
 gi|222119592|dbj|BAH16927.1| 30S ribosomal protein S11 [Macrococcus caseolyticus JCSC5402]
          Length = 129

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT +TITD  GN ++WSS   +GF GSRK++PFAAQ+A++
Sbjct: 9   KRRVKKNIENGVAHIRSTFNNTIVTITDEFGNALSWSSAGALGFRGSRKSTPFAAQMASE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             S  A  HG+ ++EV V G G GR++A+RAL++ G  I +I DVT + HNGCRP KRRR
Sbjct: 69  TASKAAMEHGLKTVEVTVKGPGQGREAAIRALQSAGLEITAIKDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|212709002|ref|ZP_03317130.1| hypothetical protein PROVALCAL_00034 [Providencia alcalifaciens DSM
           30120]
 gi|212688368|gb|EEB47896.1| hypothetical protein PROVALCAL_00034 [Providencia alcalifaciens DSM
           30120]
          Length = 129

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAESVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|254437876|ref|ZP_05051370.1| ribosomal protein S11 [Octadecabacter antarcticus 307]
 gi|254449426|ref|ZP_05062863.1| ribosomal protein S11 [Octadecabacter antarcticus 238]
 gi|198253322|gb|EDY77636.1| ribosomal protein S11 [Octadecabacter antarcticus 307]
 gi|198263832|gb|EDY88102.1| ribosomal protein S11 [Octadecabacter antarcticus 238]
          Length = 129

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 95/129 (73%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M + P R + +  KNI +G AHV S+FNNT I I+D  GN IAWSS   +GF GSRK++P
Sbjct: 1   MARDPKRTKKKVSKNIAAGVAHVNSSFNNTTILISDVQGNAIAWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D + KAQ HG+ +LEV+V G G+GR+SALRAL A G  + SI DVT +AHNG
Sbjct: 61  YAAQMAAEDVAKKAQEHGVKTLEVEVQGPGSGRESALRALAAAGLNVTSIRDVTPMAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|322831095|ref|YP_004211122.1| 30S ribosomal protein S11 [Rahnella sp. Y9602]
 gi|321166296|gb|ADW71995.1| 30S ribosomal protein S11 [Rahnella sp. Y9602]
          Length = 129

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPVRTRKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|221064827|ref|ZP_03540932.1| ribosomal protein S11 [Comamonas testosteroni KF-1]
 gi|264680562|ref|YP_003280472.1| ribosomal protein S11 [Comamonas testosteroni CNB-2]
 gi|299532874|ref|ZP_07046261.1| 30S ribosomal protein S11 [Comamonas testosteroni S44]
 gi|220709850|gb|EED65218.1| ribosomal protein S11 [Comamonas testosteroni KF-1]
 gi|262211078|gb|ACY35176.1| ribosomal protein S11 [Comamonas testosteroni CNB-2]
 gi|298719098|gb|EFI60068.1| 30S ribosomal protein S11 [Comamonas testosteroni S44]
          Length = 134

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 72/134 (53%), Positives = 94/134 (70%), Gaps = 5/134 (3%)

Query: 1   MPKSPS-----RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGS 55
           M KSP+     R+R + RKNI  G AHV ++FNNT ITITD  GN ++W+S    GF GS
Sbjct: 1   MAKSPANNAAARVRKKVRKNISDGIAHVHASFNNTIITITDRQGNALSWASSGGQGFKGS 60

Query: 56  RKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTM 115
           RK++PFAAQVA++     A   G+ +LEV++ G G GR+S++RAL A+G  I SI DVT 
Sbjct: 61  RKSTPFAAQVASEVAGRAAIEQGIKNLEVEIKGPGPGRESSVRALGALGIRITSISDVTP 120

Query: 116 IAHNGCRPRKRRRI 129
           + HNGCRP+KRRRI
Sbjct: 121 VPHNGCRPQKRRRI 134


>gi|224477195|ref|YP_002634801.1| 30S ribosomal protein S11 [Staphylococcus carnosus subsp. carnosus
           TM300]
 gi|254811043|sp|B9DM52|RS11_STACT RecName: Full=30S ribosomal protein S11
 gi|222421802|emb|CAL28616.1| 30S ribosomal protein S11 [Staphylococcus carnosus subsp. carnosus
           TM300]
          Length = 129

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KN+ +G AH+ STFNNT +TITD  GN ++WSS   +GF GS+K++PFAAQ+A++
Sbjct: 9   KRRVKKNVENGVAHIRSTFNNTIVTITDEFGNALSWSSAGALGFKGSKKSTPFAAQMASE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             S  A  HG+ S+EV V G G GR+SA+RAL++ G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TASKTAMEHGLKSVEVTVKGPGPGRESAIRALQSAGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|85713165|ref|ZP_01044197.1| 30S ribosomal protein S11 [Idiomarina baltica OS145]
 gi|85693035|gb|EAQ31001.1| 30S ribosomal protein S11 [Idiomarina baltica OS145]
          Length = 129

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 92/129 (71%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+ +R R R +K +  G AHV ++FNNT ITITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKAQTRSRKRVKKQVADGMAHVHASFNNTIITITDRQGNALAWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     A+ +G+ +LEV V+G G GR+S++RAL A+G+ I +I DVT I HNG
Sbjct: 61  FAAQVAAERAGEMAKEYGLKNLEVFVNGPGPGRESSIRALNAVGYRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|22127883|ref|NP_671306.1| 30S ribosomal protein S11 [Yersinia pestis KIM 10]
 gi|45440090|ref|NP_991629.1| 30S ribosomal protein S11 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51597965|ref|YP_072156.1| 30S ribosomal protein S11 [Yersinia pseudotuberculosis IP 32953]
 gi|108809232|ref|YP_653148.1| 30S ribosomal protein S11 [Yersinia pestis Antiqua]
 gi|108813997|ref|YP_649764.1| 30S ribosomal protein S11 [Yersinia pestis Nepal516]
 gi|145597473|ref|YP_001161548.1| 30S ribosomal protein S11 [Yersinia pestis Pestoides F]
 gi|150260720|ref|ZP_01917448.1| 30S ribosomal protein S11 [Yersinia pestis CA88-4125]
 gi|153949132|ref|YP_001402840.1| 30S ribosomal protein S11 [Yersinia pseudotuberculosis IP 31758]
 gi|162418448|ref|YP_001605195.1| 30S ribosomal protein S11 [Yersinia pestis Angola]
 gi|165927836|ref|ZP_02223668.1| ribosomal protein S11 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|166010563|ref|ZP_02231461.1| ribosomal protein S11 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166213364|ref|ZP_02239399.1| ribosomal protein S11 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399239|ref|ZP_02304763.1| ribosomal protein S11 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167419332|ref|ZP_02311085.1| ribosomal protein S11 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425723|ref|ZP_02317476.1| ribosomal protein S11 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170022567|ref|YP_001719072.1| 30S ribosomal protein S11 [Yersinia pseudotuberculosis YPIII]
 gi|186897161|ref|YP_001874273.1| 30S ribosomal protein S11 [Yersinia pseudotuberculosis PB1/+]
 gi|218927438|ref|YP_002345313.1| 30S ribosomal protein S11 [Yersinia pestis CO92]
 gi|229836286|ref|ZP_04456453.1| 30S ribosomal subunit protein S11 [Yersinia pestis Pestoides A]
 gi|229840090|ref|ZP_04460249.1| 30S ribosomal subunit protein S11 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229842172|ref|ZP_04462327.1| 30S ribosomal subunit protein S11 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229904528|ref|ZP_04519639.1| 30S ribosomal subunit protein S11 [Yersinia pestis Nepal516]
 gi|270488254|ref|ZP_06205328.1| 30S ribosomal protein S11 [Yersinia pestis KIM D27]
 gi|294502307|ref|YP_003566369.1| 30S ribosomal protein S11 [Yersinia pestis Z176003]
 gi|37138829|sp|Q8ZJ89|RS11_YERPE RecName: Full=30S ribosomal protein S11
 gi|59798662|sp|Q664U4|RS11_YERPS RecName: Full=30S ribosomal protein S11
 gi|122979879|sp|Q1CCW6|RS11_YERPN RecName: Full=30S ribosomal protein S11
 gi|123372100|sp|Q1C2W9|RS11_YERPA RecName: Full=30S ribosomal protein S11
 gi|152060833|sp|A4TH13|RS11_YERPP RecName: Full=30S ribosomal protein S11
 gi|166991583|sp|A7FNL2|RS11_YERP3 RecName: Full=30S ribosomal protein S11
 gi|226708439|sp|B2K514|RS11_YERPB RecName: Full=30S ribosomal protein S11
 gi|226708440|sp|A9R916|RS11_YERPG RecName: Full=30S ribosomal protein S11
 gi|226708441|sp|B1JJG8|RS11_YERPY RecName: Full=30S ribosomal protein S11
 gi|21961019|gb|AAM87557.1|AE014003_15 30S ribosomal subunit protein S11 [Yersinia pestis KIM 10]
 gi|45434945|gb|AAS60506.1| 30S ribosomal protein S11 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51591247|emb|CAH22913.1| 30S ribosomal protein S11 [Yersinia pseudotuberculosis IP 32953]
 gi|108777645|gb|ABG20164.1| SSU ribosomal protein S11P [Yersinia pestis Nepal516]
 gi|108781145|gb|ABG15203.1| SSU ribosomal protein S11P [Yersinia pestis Antiqua]
 gi|115346049|emb|CAL18915.1| 30S ribosomal protein S11 [Yersinia pestis CO92]
 gi|145209169|gb|ABP38576.1| SSU ribosomal protein S11P [Yersinia pestis Pestoides F]
 gi|149290128|gb|EDM40205.1| 30S ribosomal protein S11 [Yersinia pestis CA88-4125]
 gi|152960627|gb|ABS48088.1| ribosomal protein S11 [Yersinia pseudotuberculosis IP 31758]
 gi|162351263|gb|ABX85211.1| ribosomal protein S11 [Yersinia pestis Angola]
 gi|165920112|gb|EDR37413.1| ribosomal protein S11 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165990653|gb|EDR42954.1| ribosomal protein S11 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166205662|gb|EDR50142.1| ribosomal protein S11 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166963326|gb|EDR59347.1| ribosomal protein S11 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167051743|gb|EDR63151.1| ribosomal protein S11 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055413|gb|EDR65207.1| ribosomal protein S11 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169749101|gb|ACA66619.1| ribosomal protein S11 [Yersinia pseudotuberculosis YPIII]
 gi|186700187|gb|ACC90816.1| ribosomal protein S11 [Yersinia pseudotuberculosis PB1/+]
 gi|229678646|gb|EEO74751.1| 30S ribosomal subunit protein S11 [Yersinia pestis Nepal516]
 gi|229690482|gb|EEO82536.1| 30S ribosomal subunit protein S11 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229696456|gb|EEO86503.1| 30S ribosomal subunit protein S11 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229706354|gb|EEO92361.1| 30S ribosomal subunit protein S11 [Yersinia pestis Pestoides A]
 gi|262360387|gb|ACY57108.1| 30S ribosomal protein S11 [Yersinia pestis D106004]
 gi|270336758|gb|EFA47535.1| 30S ribosomal protein S11 [Yersinia pestis KIM D27]
 gi|294352766|gb|ADE63107.1| 30S ribosomal protein S11 [Yersinia pestis Z176003]
 gi|320013365|gb|ADV96936.1| 30S ribosomal subunit protein S11 [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 129

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPIRARKRVRKTVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|16766706|ref|NP_462321.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|56415336|ref|YP_152411.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62181922|ref|YP_218339.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161616443|ref|YP_001590407.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|168264702|ref|ZP_02686675.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|168468026|ref|ZP_02701863.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|194443473|ref|YP_002042668.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194448753|ref|YP_002047441.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194472213|ref|ZP_03078197.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194735800|ref|YP_002116360.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197247558|ref|YP_002148337.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197261685|ref|ZP_03161759.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|198246176|ref|YP_002217380.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200388860|ref|ZP_03215472.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204931410|ref|ZP_03222079.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205354955|ref|YP_002228756.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|224585212|ref|YP_002639011.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238913868|ref|ZP_04657705.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|17865715|sp|O54296|RS11_SALTY RecName: Full=30S ribosomal protein S11
 gi|62287385|sp|Q5PK08|RS11_SALPA RecName: Full=30S ribosomal protein S11
 gi|75480369|sp|Q57J54|RS11_SALCH RecName: Full=30S ribosomal protein S11
 gi|189040433|sp|A9N8C1|RS11_SALPB RecName: Full=30S ribosomal protein S11
 gi|226708409|sp|B5F7S3|RS11_SALA4 RecName: Full=30S ribosomal protein S11
 gi|226708410|sp|B5FJJ2|RS11_SALDC RecName: Full=30S ribosomal protein S11
 gi|226708411|sp|B5RH38|RS11_SALG2 RecName: Full=30S ribosomal protein S11
 gi|226708412|sp|B4TJY7|RS11_SALHS RecName: Full=30S ribosomal protein S11
 gi|226708413|sp|B4SUR8|RS11_SALNS RecName: Full=30S ribosomal protein S11
 gi|226708414|sp|B4TXC0|RS11_SALSV RecName: Full=30S ribosomal protein S11
 gi|254811041|sp|C0PZW0|RS11_SALPC RecName: Full=30S ribosomal protein S11
 gi|16421973|gb|AAL22280.1| 30S ribosomal subunit protein S11 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|56129593|gb|AAV79099.1| 30S ribosomal subunit protein S11 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62129555|gb|AAX67258.1| 30S ribosomal subunit protein S11 [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161365807|gb|ABX69575.1| hypothetical protein SPAB_04258 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402136|gb|ACF62358.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194407057|gb|ACF67276.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194458577|gb|EDX47416.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194711302|gb|ACF90523.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195628907|gb|EDX48317.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197211261|gb|ACH48658.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197239940|gb|EDY22560.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197940692|gb|ACH78025.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|199605958|gb|EDZ04503.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204319838|gb|EDZ05048.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205274736|emb|CAR39792.1| 30S ribosomal subunit protein S11 [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205346874|gb|EDZ33505.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|224469740|gb|ACN47570.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|267995626|gb|ACY90511.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|312914440|dbj|BAJ38414.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320087862|emb|CBY97625.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|322615042|gb|EFY11966.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617329|gb|EFY14230.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625551|gb|EFY22376.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322626393|gb|EFY23202.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632095|gb|EFY28848.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635026|gb|EFY31749.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322643273|gb|EFY39840.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322646643|gb|EFY43150.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322649989|gb|EFY46408.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322652706|gb|EFY49046.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322659537|gb|EFY55781.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665521|gb|EFY61708.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322670415|gb|EFY66554.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322670488|gb|EFY66622.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322675064|gb|EFY71147.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681601|gb|EFY77630.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322685945|gb|EFY81934.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322716408|gb|EFZ07979.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323131775|gb|ADX19205.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|323195815|gb|EFZ80988.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196429|gb|EFZ81580.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202332|gb|EFZ87377.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323207319|gb|EFZ92269.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211245|gb|EFZ96090.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323216046|gb|EGA00777.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323223463|gb|EGA07791.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323226807|gb|EGA10997.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323231831|gb|EGA15941.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233216|gb|EGA17311.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323237283|gb|EGA21348.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323245518|gb|EGA29517.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249024|gb|EGA32946.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323250647|gb|EGA34528.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256876|gb|EGA40590.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323263025|gb|EGA46572.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323266025|gb|EGA49520.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323272782|gb|EGA56185.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|326625161|gb|EGE31506.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326630104|gb|EGE36447.1| ribosomal protein S11 [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 129

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPVRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|304321463|ref|YP_003855106.1| 30S ribosomal protein S11 [Parvularcula bermudensis HTCC2503]
 gi|303300365|gb|ADM09964.1| 30S ribosomal protein S11 [Parvularcula bermudensis HTCC2503]
          Length = 131

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 99/131 (75%), Gaps = 2/131 (1%)

Query: 1   MPKSPSR--IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKN 58
           M + P R  +R RERKNIV+G  HV ++FNNT +TITD  GN ++WSS   +GF GSRK+
Sbjct: 1   MARQPQRQAVRRRERKNIVNGVVHVNASFNNTMVTITDEQGNAVSWSSAGHMGFKGSRKS 60

Query: 59  SPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAH 118
           +PFAAQ+A +D + KA +HG+ S++V V G G+GR+SALRAL++ G T+ +I DVT I H
Sbjct: 61  TPFAAQMAAEDAAKKAMDHGLKSVDVLVRGPGSGRESALRALQSAGLTVTNIRDVTPIPH 120

Query: 119 NGCRPRKRRRI 129
           NG RPRKRRR+
Sbjct: 121 NGVRPRKRRRV 131


>gi|237728632|ref|ZP_04559113.1| 30S ribosomal subunit protein S11 [Citrobacter sp. 30_2]
 gi|283835714|ref|ZP_06355455.1| hypothetical protein CIT292_10107 [Citrobacter youngae ATCC 29220]
 gi|296105005|ref|YP_003615151.1| 30S ribosomal protein S11 [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|226909254|gb|EEH95172.1| 30S ribosomal subunit protein S11 [Citrobacter sp. 30_2]
 gi|291068394|gb|EFE06503.1| 30S ribosomal protein S11 [Citrobacter youngae ATCC 29220]
 gi|295059464|gb|ADF64202.1| 30S ribosomal protein S11 [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 129

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEAVKEYGIKNLEVMVKGPGPGRESTVRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|210623213|ref|ZP_03293652.1| hypothetical protein CLOHIR_01602 [Clostridium hiranonis DSM 13275]
 gi|210153750|gb|EEA84756.1| hypothetical protein CLOHIR_01602 [Clostridium hiranonis DSM 13275]
          Length = 132

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 92/127 (72%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K  +R+R +ERKNI  G AH+ STFNNT +T+TD HGN I+W+S   +GF GSRK +PFA
Sbjct: 6   KKVTRVRRKERKNIERGHAHIQSTFNNTIVTLTDVHGNAISWASSGQLGFKGSRKATPFA 65

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           +Q+A +  +  A  HG+ ++EV V G G+GR++A+RAL+A G  +  I DVT I HNGCR
Sbjct: 66  SQMAAETAAKAAMEHGLKTVEVFVKGPGSGREAAIRALQATGLEVTMIKDVTPIPHNGCR 125

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 126 PPKRRRV 132


>gi|257870542|ref|ZP_05650195.1| ribosomal protein S11 [Enterococcus gallinarum EG2]
 gi|257804706|gb|EEV33528.1| ribosomal protein S11 [Enterococcus gallinarum EG2]
          Length = 129

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT I ITD HGN +AWSS   +GF GS+K++PFAAQ+A +
Sbjct: 9   KRRVKKNIEAGIAHIHSTFNNTIIMITDTHGNALAWSSAGSLGFKGSKKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ ++EV V G G+GR++A+R+L+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TATKAAMEHGLRTVEVTVKGPGSGREAAIRSLQAAGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|237806898|ref|YP_002891338.1| 30S ribosomal protein S11 [Tolumonas auensis DSM 9187]
 gi|259494639|sp|C4L7V3|RS11_TOLAT RecName: Full=30S ribosomal protein S11
 gi|237499159|gb|ACQ91752.1| ribosomal protein S11 [Tolumonas auensis DSM 9187]
          Length = 129

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 91/129 (70%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P+R R R RK +  G AHV ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKAPTRARKRVRKQVSDGIAHVHASFNNTIVTITDRQGNALSWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     A+ +G+ +LEV V G G GR+S++RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERAGEIAKEYGVKNLEVMVKGPGPGRESSIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|118595312|ref|ZP_01552659.1| 30S ribosomal protein S11 [Methylophilales bacterium HTCC2181]
 gi|118441090|gb|EAV47717.1| 30S ribosomal protein S11 [Methylophilales bacterium HTCC2181]
          Length = 129

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 92/129 (71%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+  RI+ + +KN+  G AHV ++FNNT ITITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKANVRIKKKVKKNVSEGIAHVHASFNNTIITITDRQGNALSWATSGGAGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA ++    AQ  G+ ++EV++ G G GR+S++RAL A+G  I SI DVT + HNG
Sbjct: 61  FAAQVAAENAGKAAQEFGVKNIEVRIKGPGPGRESSVRALNAVGLKITSIQDVTPVPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RRI
Sbjct: 121 CRPPKKRRI 129


>gi|15925215|ref|NP_372749.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15927805|ref|NP_375338.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21283873|ref|NP_646961.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus MW2]
 gi|49484441|ref|YP_041665.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49487007|ref|YP_044228.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57650809|ref|YP_187024.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus COL]
 gi|70725828|ref|YP_252742.1| 30S ribosomal protein S11 [Staphylococcus haemolyticus JCSC1435]
 gi|82751815|ref|YP_417556.1| 30S ribosomal protein S11 [Staphylococcus aureus RF122]
 gi|87162098|ref|YP_494814.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88196137|ref|YP_500954.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|148268665|ref|YP_001247608.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus JH9]
 gi|150394730|ref|YP_001317405.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus JH1]
 gi|151222339|ref|YP_001333161.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156980540|ref|YP_001442799.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus Mu3]
 gi|161510429|ref|YP_001576088.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221140173|ref|ZP_03564666.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|223042606|ref|ZP_03612655.1| 30S ribosomal protein S11 [Staphylococcus capitis SK14]
 gi|228474577|ref|ZP_04059308.1| 30S ribosomal protein S11 [Staphylococcus hominis SK119]
 gi|242371872|ref|ZP_04817446.1| 30S ribosomal protein S11 [Staphylococcus epidermidis M23864:W1]
 gi|253316986|ref|ZP_04840199.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus str.
           CF-Marseille]
 gi|253729891|ref|ZP_04864056.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253734366|ref|ZP_04868531.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255007005|ref|ZP_05145606.2| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257423710|ref|ZP_05600139.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257426388|ref|ZP_05602790.1| ribosomal protein S11 [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257429028|ref|ZP_05605415.1| ribosomal protein S11 [Staphylococcus aureus subsp. aureus 68-397]
 gi|257431674|ref|ZP_05608037.1| ribosomal protein S11 [Staphylococcus aureus subsp. aureus E1410]
 gi|257434634|ref|ZP_05610685.1| SSU ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           M876]
 gi|257794571|ref|ZP_05643550.1| 30S ribosomal protein S11 [Staphylococcus aureus A9781]
 gi|258408827|ref|ZP_05681111.1| 30S ribosomal protein S11 [Staphylococcus aureus A9763]
 gi|258422426|ref|ZP_05685338.1| SSU ribosomal protein S11 [Staphylococcus aureus A9719]
 gi|258422672|ref|ZP_05685577.1| SSU ribosomal protein S11 [Staphylococcus aureus A9635]
 gi|258439814|ref|ZP_05690560.1| 30S ribosomal protein S11 [Staphylococcus aureus A9299]
 gi|258442630|ref|ZP_05691190.1| ribosomal protein S11 [Staphylococcus aureus A8115]
 gi|258446672|ref|ZP_05694827.1| 30S ribosomal protein S11 [Staphylococcus aureus A6300]
 gi|258450210|ref|ZP_05698302.1| ribosomal protein S11 [Staphylococcus aureus A6224]
 gi|258450779|ref|ZP_05698838.1| 30S ribosomal protein S11 [Staphylococcus aureus A5948]
 gi|258455418|ref|ZP_05703378.1| 30S ribosomal protein S11 [Staphylococcus aureus A5937]
 gi|262048493|ref|ZP_06021377.1| 30S ribosomal protein S11 [Staphylococcus aureus D30]
 gi|262052018|ref|ZP_06024229.1| 30S ribosomal protein S11 [Staphylococcus aureus 930918-3]
 gi|269203858|ref|YP_003283127.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282893664|ref|ZP_06301896.1| 30S ribosomal protein S11 [Staphylococcus aureus A8117]
 gi|282902128|ref|ZP_06310021.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           C160]
 gi|282906568|ref|ZP_06314416.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282909538|ref|ZP_06317349.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282911786|ref|ZP_06319582.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282915074|ref|ZP_06322851.1| ribosomal protein S11 [Staphylococcus aureus subsp. aureus M899]
 gi|282917570|ref|ZP_06325322.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282920800|ref|ZP_06328518.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282922094|ref|ZP_06329790.1| 30S ribosomal protein S11 [Staphylococcus aureus A9765]
 gi|282925705|ref|ZP_06333353.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           C101]
 gi|282926771|ref|ZP_06334398.1| 30S ribosomal protein S11 [Staphylococcus aureus A10102]
 gi|283767317|ref|ZP_06340232.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus H19]
 gi|283959003|ref|ZP_06376444.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|284025251|ref|ZP_06379649.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus 132]
 gi|289550168|ref|YP_003471072.1| SSU ribosomal protein S11p (S14e) [Staphylococcus lugdunensis
           HKU09-01]
 gi|293497478|ref|ZP_06665332.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293511053|ref|ZP_06669750.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           M809]
 gi|293549659|ref|ZP_06672331.1| ribosomal protein S11 [Staphylococcus aureus subsp. aureus M1015]
 gi|294848758|ref|ZP_06789503.1| 30S ribosomal protein S11 [Staphylococcus aureus A9754]
 gi|295404901|ref|ZP_06814714.1| 30S ribosomal protein S11 [Staphylococcus aureus A8819]
 gi|295428808|ref|ZP_06821432.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296275984|ref|ZP_06858491.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus MR1]
 gi|297209962|ref|ZP_06926358.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297243959|ref|ZP_06927849.1| 30S ribosomal protein S11 [Staphylococcus aureus A8796]
 gi|297589706|ref|ZP_06948347.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus MN8]
 gi|300910974|ref|ZP_07128424.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|304379409|ref|ZP_07362144.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|314934273|ref|ZP_07841632.1| 30S ribosomal protein S11 [Staphylococcus caprae C87]
 gi|314935856|ref|ZP_07843208.1| 30S ribosomal protein S11 [Staphylococcus hominis subsp. hominis
           C80]
 gi|315659202|ref|ZP_07912066.1| 30S ribosomal protein S11 [Staphylococcus lugdunensis M23590]
 gi|54039333|sp|P66357|RS11_STAAN RecName: Full=30S ribosomal protein S11
 gi|54039334|sp|P66358|RS11_STAAW RecName: Full=30S ribosomal protein S11
 gi|54042110|sp|P66356|RS11_STAAM RecName: Full=30S ribosomal protein S11
 gi|56749505|sp|Q6G796|RS11_STAAS RecName: Full=30S ribosomal protein S11
 gi|56749552|sp|Q6GEK8|RS11_STAAR RecName: Full=30S ribosomal protein S11
 gi|62287348|sp|Q5HDY3|RS11_STAAC RecName: Full=30S ribosomal protein S11
 gi|82581613|sp|Q4L889|RS11_STAHJ RecName: Full=30S ribosomal protein S11
 gi|91207680|sp|Q2YYM1|RS11_STAAB RecName: Full=30S ribosomal protein S11
 gi|123003433|sp|Q2FW31|RS11_STAA8 RecName: Full=30S ribosomal protein S11
 gi|123749580|sp|Q2FER4|RS11_STAA3 RecName: Full=30S ribosomal protein S11
 gi|166231837|sp|A7X5C5|RS11_STAA1 RecName: Full=30S ribosomal protein S11
 gi|172049006|sp|A6QJ67|RS11_STAAE RecName: Full=30S ribosomal protein S11
 gi|189040439|sp|A6U3V0|RS11_STAA2 RecName: Full=30S ribosomal protein S11
 gi|189040440|sp|A5IV09|RS11_STAA9 RecName: Full=30S ribosomal protein S11
 gi|189040441|sp|A8Z332|RS11_STAAT RecName: Full=30S ribosomal protein S11
 gi|13702025|dbj|BAB43317.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           N315]
 gi|14247998|dbj|BAB58387.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|21205315|dbj|BAB96009.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus MW2]
 gi|49242570|emb|CAG41291.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49245450|emb|CAG43927.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57284995|gb|AAW37089.1| ribosomal protein S11 [Staphylococcus aureus subsp. aureus COL]
 gi|68446552|dbj|BAE04136.1| 30S ribosomal protein S11 [Staphylococcus haemolyticus JCSC1435]
 gi|82657346|emb|CAI81787.1| 30S ribosomal protein S11 [Staphylococcus aureus RF122]
 gi|87128072|gb|ABD22586.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87203695|gb|ABD31505.1| ribosomal protein S11, putative [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|147741734|gb|ABQ50032.1| SSU ribosomal protein S11P [Staphylococcus aureus subsp. aureus
           JH9]
 gi|149947182|gb|ABR53118.1| ribosomal protein S11 [Staphylococcus aureus subsp. aureus JH1]
 gi|150375139|dbj|BAF68399.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156722675|dbj|BAF79092.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus Mu3]
 gi|160369238|gb|ABX30209.1| ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|222444269|gb|EEE50365.1| 30S ribosomal protein S11 [Staphylococcus capitis SK14]
 gi|228271240|gb|EEK12608.1| 30S ribosomal protein S11 [Staphylococcus hominis SK119]
 gi|242350379|gb|EES41980.1| 30S ribosomal protein S11 [Staphylococcus epidermidis M23864:W1]
 gi|253726338|gb|EES95067.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253727683|gb|EES96412.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257272728|gb|EEV04830.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257276019|gb|EEV07470.1| ribosomal protein S11 [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257279509|gb|EEV10096.1| ribosomal protein S11 [Staphylococcus aureus subsp. aureus 68-397]
 gi|257282553|gb|EEV12685.1| ribosomal protein S11 [Staphylococcus aureus subsp. aureus E1410]
 gi|257285230|gb|EEV15346.1| SSU ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           M876]
 gi|257788543|gb|EEV26883.1| 30S ribosomal protein S11 [Staphylococcus aureus A9781]
 gi|257840510|gb|EEV64970.1| 30S ribosomal protein S11 [Staphylococcus aureus A9763]
 gi|257841857|gb|EEV66294.1| SSU ribosomal protein S11 [Staphylococcus aureus A9719]
 gi|257847083|gb|EEV71092.1| SSU ribosomal protein S11 [Staphylococcus aureus A9635]
 gi|257847590|gb|EEV71592.1| 30S ribosomal protein S11 [Staphylococcus aureus A9299]
 gi|257851751|gb|EEV75685.1| ribosomal protein S11 [Staphylococcus aureus A8115]
 gi|257854740|gb|EEV77688.1| 30S ribosomal protein S11 [Staphylococcus aureus A6300]
 gi|257856302|gb|EEV79211.1| ribosomal protein S11 [Staphylococcus aureus A6224]
 gi|257861562|gb|EEV84364.1| 30S ribosomal protein S11 [Staphylococcus aureus A5948]
 gi|257862629|gb|EEV85397.1| 30S ribosomal protein S11 [Staphylococcus aureus A5937]
 gi|259160073|gb|EEW45106.1| 30S ribosomal protein S11 [Staphylococcus aureus 930918-3]
 gi|259163351|gb|EEW47909.1| 30S ribosomal protein S11 [Staphylococcus aureus D30]
 gi|262076148|gb|ACY12121.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269941814|emb|CBI50224.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282312534|gb|EFB42938.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           C101]
 gi|282315215|gb|EFB45599.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282318532|gb|EFB48890.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282320795|gb|EFB51129.1| ribosomal protein S11 [Staphylococcus aureus subsp. aureus M899]
 gi|282323482|gb|EFB53798.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282326517|gb|EFB56819.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282329467|gb|EFB58988.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282591222|gb|EFB96295.1| 30S ribosomal protein S11 [Staphylococcus aureus A10102]
 gi|282593562|gb|EFB98555.1| 30S ribosomal protein S11 [Staphylococcus aureus A9765]
 gi|282596587|gb|EFC01546.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           C160]
 gi|282763722|gb|EFC03850.1| 30S ribosomal protein S11 [Staphylococcus aureus A8117]
 gi|283461196|gb|EFC08280.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus H19]
 gi|283471447|emb|CAQ50658.1| ribosomal protein S11 [Staphylococcus aureus subsp. aureus ST398]
 gi|283788595|gb|EFC27422.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|285817887|gb|ADC38374.1| 30S ribosomal protein S11 [Staphylococcus aureus 04-02981]
 gi|289179700|gb|ADC86945.1| SSU ribosomal protein S11p (S14e) [Staphylococcus lugdunensis
           HKU09-01]
 gi|290918706|gb|EFD95782.1| ribosomal protein S11 [Staphylococcus aureus subsp. aureus M1015]
 gi|291096409|gb|EFE26667.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466040|gb|EFF08569.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           M809]
 gi|294824137|gb|EFG40561.1| 30S ribosomal protein S11 [Staphylococcus aureus A9754]
 gi|294969846|gb|EFG45864.1| 30S ribosomal protein S11 [Staphylococcus aureus A8819]
 gi|295127157|gb|EFG56799.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296885635|gb|EFH24572.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297178737|gb|EFH37982.1| 30S ribosomal protein S11 [Staphylococcus aureus A8796]
 gi|297578217|gb|EFH96930.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus MN8]
 gi|298695482|gb|ADI98704.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           ED133]
 gi|300887954|gb|EFK83149.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|302333861|gb|ADL24054.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           JKD6159]
 gi|302752098|gb|ADL66275.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus str.
           JKD6008]
 gi|304341941|gb|EFM07845.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312437364|gb|ADQ76435.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|312830574|emb|CBX35416.1| 30S ribosomal protein S11 (BS11) [Staphylococcus aureus subsp.
           aureus ECT-R 2]
 gi|313652203|gb|EFS15966.1| 30S ribosomal protein S11 [Staphylococcus caprae C87]
 gi|313656421|gb|EFS20161.1| 30S ribosomal protein S11 [Staphylococcus hominis subsp. hominis
           C80]
 gi|315129695|gb|EFT85686.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315193477|gb|EFU23873.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           CGS00]
 gi|315198245|gb|EFU28576.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|315495627|gb|EFU83958.1| 30S ribosomal protein S11 [Staphylococcus lugdunensis M23590]
 gi|320140237|gb|EFW32096.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320143507|gb|EFW35288.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|323440095|gb|EGA97810.1| 30S ribosomal protein S11 [Staphylococcus aureus O11]
 gi|323442769|gb|EGB00395.1| 30S ribosomal protein S11 [Staphylococcus aureus O46]
 gi|329314908|gb|AEB89321.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329723548|gb|EGG60077.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           21172]
 gi|329730336|gb|EGG66726.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           21193]
 gi|329732000|gb|EGG68355.1| 30S ribosomal protein S11 [Staphylococcus aureus subsp. aureus
           21189]
          Length = 129

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT +TITD  GN ++WSS   +GF GS+K++PFAAQ+A++
Sbjct: 9   KRRVKKNIENGVAHIRSTFNNTIVTITDEFGNALSWSSAGALGFKGSKKSTPFAAQMASE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             S  A  HG+ ++EV V G G GR+SA+RAL++ G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TASKSAMEHGLKTVEVTVKGPGPGRESAIRALQSAGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|73542840|ref|YP_297360.1| 30S ribosomal protein S11 [Ralstonia eutropha JMP134]
 gi|113869407|ref|YP_727896.1| 30S ribosomal protein S11 [Ralstonia eutropha H16]
 gi|194290999|ref|YP_002006906.1| 30S ribosomal protein s11 [Cupriavidus taiwanensis LMG 19424]
 gi|91207674|sp|Q46WG7|RS11_RALEJ RecName: Full=30S ribosomal protein S11
 gi|123328831|sp|Q0K643|RS11_RALEH RecName: Full=30S ribosomal protein S11
 gi|226708354|sp|B3R7E5|RS11_CUPTR RecName: Full=30S ribosomal protein S11
 gi|72120253|gb|AAZ62516.1| SSU ribosomal protein S11P [Ralstonia eutropha JMP134]
 gi|113528183|emb|CAJ94528.1| SSU ribosomal protein S11 [Ralstonia eutropha H16]
 gi|193224834|emb|CAQ70845.1| 30S ribosomal subunit protein S11 [Cupriavidus taiwanensis LMG
           19424]
          Length = 132

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 91/128 (71%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           P + +R R + +KN+  G AHV ++FNNT ITITD  GN ++W++    GF GSRK++PF
Sbjct: 5   PNNAARARKKVKKNVADGIAHVHASFNNTIITITDRQGNALSWATAGGQGFKGSRKSTPF 64

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQVA ++    AQ+ G+ +LEV++ G G GR+SA+RAL A+G  I  I DVT I HNGC
Sbjct: 65  AAQVAAENAGRVAQDQGIKNLEVRIKGPGPGRESAVRALNALGIKIAIIEDVTPIPHNGC 124

Query: 122 RPRKRRRI 129
           RP KRRRI
Sbjct: 125 RPPKRRRI 132


>gi|27468716|ref|NP_765353.1| 30S ribosomal protein S11 [Staphylococcus epidermidis ATCC 12228]
 gi|57867676|ref|YP_189369.1| 30S ribosomal protein S11 [Staphylococcus epidermidis RP62A]
 gi|242243972|ref|ZP_04798415.1| ribosomal protein S11 [Staphylococcus epidermidis W23144]
 gi|251812072|ref|ZP_04826545.1| ribosomal protein S11 [Staphylococcus epidermidis BCM-HMP0060]
 gi|282875367|ref|ZP_06284240.1| 30S ribosomal protein S11 [Staphylococcus epidermidis SK135]
 gi|293368458|ref|ZP_06615082.1| 30S ribosomal protein S11 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|34582665|sp|P59377|RS11_STAES RecName: Full=30S ribosomal protein S11
 gi|81673642|sp|Q5HM24|RS11_STAEQ RecName: Full=30S ribosomal protein S11
 gi|27316264|gb|AAO05439.1|AE016750_44 30S ribosomal protein S11 [Staphylococcus epidermidis ATCC 12228]
 gi|57638334|gb|AAW55122.1| ribosomal protein S11 [Staphylococcus epidermidis RP62A]
 gi|242232605|gb|EES34917.1| ribosomal protein S11 [Staphylococcus epidermidis W23144]
 gi|251804406|gb|EES57063.1| ribosomal protein S11 [Staphylococcus epidermidis BCM-HMP0060]
 gi|281296132|gb|EFA88653.1| 30S ribosomal protein S11 [Staphylococcus epidermidis SK135]
 gi|291317416|gb|EFE57838.1| 30S ribosomal protein S11 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|319400600|gb|EFV88825.1| 30S ribosomal protein S11 [Staphylococcus epidermidis FRI909]
 gi|329731272|gb|EGG67642.1| 30S ribosomal protein S11 [Staphylococcus epidermidis VCU144]
 gi|329736442|gb|EGG72710.1| 30S ribosomal protein S11 [Staphylococcus epidermidis VCU028]
 gi|329737051|gb|EGG73306.1| 30S ribosomal protein S11 [Staphylococcus epidermidis VCU045]
          Length = 129

 Score =  139 bits (349), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT +TITD  GN ++WSS   +GF GS+K++PFAAQ+A++
Sbjct: 9   KRRVKKNIENGVAHIRSTFNNTIVTITDEFGNALSWSSAGALGFKGSKKSTPFAAQMASE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             S  A  HG+ ++EV V G G GR+SA+RAL++ G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TASKTAMEHGLKTVEVTVKGPGPGRESAIRALQSAGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|15803824|ref|NP_289858.1| 30S ribosomal protein S11 [Escherichia coli O157:H7 EDL933]
 gi|15833416|ref|NP_312189.1| 30S ribosomal protein S11 [Escherichia coli O157:H7 str. Sakai]
 gi|16131176|ref|NP_417756.1| 30S ribosomal subunit protein S11 [Escherichia coli str. K-12
           substr. MG1655]
 gi|24114575|ref|NP_709085.1| 30S ribosomal protein S11 [Shigella flexneri 2a str. 301]
 gi|26249882|ref|NP_755922.1| 30S ribosomal protein S11 [Escherichia coli CFT073]
 gi|30065402|ref|NP_839573.1| 30S ribosomal protein S11 [Shigella flexneri 2a str. 2457T]
 gi|74313816|ref|YP_312235.1| 30S ribosomal protein S11 [Shigella sonnei Ss046]
 gi|82545660|ref|YP_409607.1| 30S ribosomal protein S11 [Shigella boydii Sb227]
 gi|82778593|ref|YP_404942.1| 30S ribosomal protein S11 [Shigella dysenteriae Sd197]
 gi|89110713|ref|AP_004493.1| 30S ribosomal subunit protein S11 [Escherichia coli str. K-12
           substr. W3110]
 gi|91212724|ref|YP_542710.1| 30S ribosomal protein S11 [Escherichia coli UTI89]
 gi|110643536|ref|YP_671266.1| 30S ribosomal protein S11 [Escherichia coli 536]
 gi|110807145|ref|YP_690665.1| 30S ribosomal protein S11 [Shigella flexneri 5 str. 8401]
 gi|117625579|ref|YP_858902.1| 30S ribosomal protein S11 [Escherichia coli APEC O1]
 gi|157156126|ref|YP_001464765.1| 30S ribosomal protein S11 [Escherichia coli E24377A]
 gi|157162771|ref|YP_001460089.1| 30S ribosomal protein S11 [Escherichia coli HS]
 gi|161506030|ref|YP_001573142.1| 30S ribosomal protein S11 [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|168752254|ref|ZP_02777276.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4113]
 gi|168758525|ref|ZP_02783532.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4401]
 gi|168764980|ref|ZP_02789987.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4501]
 gi|168769159|ref|ZP_02794166.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4486]
 gi|168777845|ref|ZP_02802852.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4196]
 gi|168783865|ref|ZP_02808872.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4076]
 gi|168786187|ref|ZP_02811194.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC869]
 gi|168802726|ref|ZP_02827733.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC508]
 gi|170018467|ref|YP_001723421.1| 30S ribosomal protein S11 [Escherichia coli ATCC 8739]
 gi|170082817|ref|YP_001732137.1| 30S ribosomal subunit protein S11 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170679818|ref|YP_001745559.1| 30S ribosomal protein S11 [Escherichia coli SMS-3-5]
 gi|170769491|ref|ZP_02903944.1| ribosomal protein S11 [Escherichia albertii TW07627]
 gi|187730089|ref|YP_001881982.1| 30S ribosomal protein S11 [Shigella boydii CDC 3083-94]
 gi|188496068|ref|ZP_03003338.1| ribosomal protein S11 [Escherichia coli 53638]
 gi|191169297|ref|ZP_03031046.1| ribosomal protein S11 [Escherichia coli B7A]
 gi|191174451|ref|ZP_03035952.1| ribosomal protein S11 [Escherichia coli F11]
 gi|193066499|ref|ZP_03047543.1| ribosomal protein S11 [Escherichia coli E22]
 gi|193071536|ref|ZP_03052445.1| ribosomal protein S11 [Escherichia coli E110019]
 gi|194430291|ref|ZP_03062786.1| ribosomal protein S11 [Escherichia coli B171]
 gi|194435074|ref|ZP_03067312.1| ribosomal protein S11 [Shigella dysenteriae 1012]
 gi|194440011|ref|ZP_03072069.1| ribosomal protein S11 [Escherichia coli 101-1]
 gi|195939845|ref|ZP_03085227.1| 30S ribosomal protein S11 [Escherichia coli O157:H7 str. EC4024]
 gi|208808796|ref|ZP_03251133.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4206]
 gi|208811888|ref|ZP_03253217.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4045]
 gi|208818549|ref|ZP_03258869.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4042]
 gi|209398081|ref|YP_002272753.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4115]
 gi|209920763|ref|YP_002294847.1| 30S ribosomal protein S11 [Escherichia coli SE11]
 gi|215488597|ref|YP_002331028.1| 30S ribosomal protein S11 [Escherichia coli O127:H6 str. E2348/69]
 gi|217324533|ref|ZP_03440617.1| ribosomal protein S11 [Escherichia coli O157:H7 str. TW14588]
 gi|218550573|ref|YP_002384364.1| 30S ribosomal protein S11 [Escherichia fergusonii ATCC 35469]
 gi|218555855|ref|YP_002388768.1| 30S ribosomal protein S11 [Escherichia coli IAI1]
 gi|218560359|ref|YP_002393272.1| 30S ribosomal protein S11 [Escherichia coli S88]
 gi|218691584|ref|YP_002399796.1| 30S ribosomal protein S11 [Escherichia coli ED1a]
 gi|218696990|ref|YP_002404657.1| 30S ribosomal protein S11 [Escherichia coli 55989]
 gi|218702060|ref|YP_002409689.1| 30S ribosomal protein S11 [Escherichia coli IAI39]
 gi|218706905|ref|YP_002414424.1| 30S ribosomal protein S11 [Escherichia coli UMN026]
 gi|227883429|ref|ZP_04001234.1| 30S ribosomal protein S11 [Escherichia coli 83972]
 gi|237703027|ref|ZP_04533508.1| 30S ribosomal subunit protein S11 [Escherichia sp. 3_2_53FAA]
 gi|238902388|ref|YP_002928184.1| 30S ribosomal subunit protein S11 [Escherichia coli BW2952]
 gi|253771879|ref|YP_003034710.1| 30S ribosomal protein S11 [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254038458|ref|ZP_04872514.1| ribosomal protein S11 [Escherichia sp. 1_1_43]
 gi|254163225|ref|YP_003046333.1| 30S ribosomal protein S11 [Escherichia coli B str. REL606]
 gi|254795234|ref|YP_003080071.1| 30S ribosomal protein S11 [Escherichia coli O157:H7 str. TW14359]
 gi|256020656|ref|ZP_05434521.1| 30S ribosomal protein S11 [Shigella sp. D9]
 gi|256025975|ref|ZP_05439840.1| 30S ribosomal protein S11 [Escherichia sp. 4_1_40B]
 gi|260846095|ref|YP_003223873.1| 30S ribosomal subunit protein S11 [Escherichia coli O103:H2 str.
           12009]
 gi|260857418|ref|YP_003231309.1| 30S ribosomal subunit protein S11 [Escherichia coli O26:H11 str.
           11368]
 gi|260870040|ref|YP_003236442.1| 30S ribosomal subunit protein S11 [Escherichia coli O111:H- str.
           11128]
 gi|261224602|ref|ZP_05938883.1| 30S ribosomal subunit protein S11 [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261254504|ref|ZP_05947037.1| 30S ribosomal subunit protein S11 [Escherichia coli O157:H7 str.
           FRIK966]
 gi|283788067|ref|YP_003367932.1| 30S ribosomal subunit protein S11 [Citrobacter rodentium ICC168]
 gi|291284655|ref|YP_003501473.1| 30S ribosomal protein S11 [Escherichia coli O55:H7 str. CB9615]
 gi|293406894|ref|ZP_06650818.1| 30S ribosomal protein S11 [Escherichia coli FVEC1412]
 gi|293412716|ref|ZP_06655384.1| 30S ribosomal protein S11 [Escherichia coli B354]
 gi|293416716|ref|ZP_06659353.1| 30S ribosomal protein S11 [Escherichia coli B185]
 gi|293453616|ref|ZP_06664035.1| 30S ribosomal protein S11 [Escherichia coli B088]
 gi|294638031|ref|ZP_06716291.1| 30S ribosomal protein S11 [Edwardsiella tarda ATCC 23685]
 gi|298382635|ref|ZP_06992230.1| 30S ribosomal protein S11 [Escherichia coli FVEC1302]
 gi|300815492|ref|ZP_07095717.1| 30S ribosomal protein S11 [Escherichia coli MS 107-1]
 gi|300822899|ref|ZP_07103035.1| 30S ribosomal protein S11 [Escherichia coli MS 119-7]
 gi|300896646|ref|ZP_07115162.1| 30S ribosomal protein S11 [Escherichia coli MS 198-1]
 gi|300903546|ref|ZP_07121468.1| 30S ribosomal protein S11 [Escherichia coli MS 84-1]
 gi|300918272|ref|ZP_07134876.1| 30S ribosomal protein S11 [Escherichia coli MS 115-1]
 gi|300921893|ref|ZP_07138049.1| 30S ribosomal protein S11 [Escherichia coli MS 182-1]
 gi|300932191|ref|ZP_07147470.1| 30S ribosomal protein S11 [Escherichia coli MS 187-1]
 gi|300935296|ref|ZP_07150306.1| 30S ribosomal protein S11 [Escherichia coli MS 21-1]
 gi|300946520|ref|ZP_07160785.1| 30S ribosomal protein S11 [Escherichia coli MS 116-1]
 gi|300954828|ref|ZP_07167254.1| 30S ribosomal protein S11 [Escherichia coli MS 175-1]
 gi|300973977|ref|ZP_07172384.1| 30S ribosomal protein S11 [Escherichia coli MS 200-1]
 gi|300979870|ref|ZP_07174746.1| 30S ribosomal protein S11 [Escherichia coli MS 45-1]
 gi|301018837|ref|ZP_07183081.1| 30S ribosomal protein S11 [Escherichia coli MS 69-1]
 gi|301021163|ref|ZP_07185201.1| 30S ribosomal protein S11 [Escherichia coli MS 196-1]
 gi|301046069|ref|ZP_07193247.1| 30S ribosomal protein S11 [Escherichia coli MS 185-1]
 gi|301305507|ref|ZP_07211599.1| 30S ribosomal protein S11 [Escherichia coli MS 124-1]
 gi|301325135|ref|ZP_07218669.1| 30S ribosomal protein S11 [Escherichia coli MS 78-1]
 gi|301643882|ref|ZP_07243913.1| 30S ribosomal protein S11 [Escherichia coli MS 146-1]
 gi|306816360|ref|ZP_07450498.1| 30S ribosomal protein S11 [Escherichia coli NC101]
 gi|307139980|ref|ZP_07499336.1| 30S ribosomal protein S11 [Escherichia coli H736]
 gi|307315124|ref|ZP_07594707.1| 30S ribosomal protein S11 [Escherichia coli W]
 gi|309785619|ref|ZP_07680250.1| ribosomal S11 family protein [Shigella dysenteriae 1617]
 gi|309794573|ref|ZP_07688995.1| 30S ribosomal protein S11 [Escherichia coli MS 145-7]
 gi|311277748|ref|YP_003939979.1| 30S ribosomal protein S11 [Enterobacter cloacae SCF1]
 gi|312968378|ref|ZP_07782588.1| ribosomal S11 family protein [Escherichia coli 2362-75]
 gi|312972442|ref|ZP_07786616.1| ribosomal S11 family protein [Escherichia coli 1827-70]
 gi|331643993|ref|ZP_08345122.1| 30S ribosomal protein S11 [Escherichia coli H736]
 gi|331649094|ref|ZP_08350180.1| 30S ribosomal protein S11 [Escherichia coli M605]
 gi|331654890|ref|ZP_08355889.1| 30S ribosomal protein S11 [Escherichia coli M718]
 gi|331659587|ref|ZP_08360525.1| 30S ribosomal protein S11 [Escherichia coli TA206]
 gi|331664910|ref|ZP_08365811.1| 30S ribosomal protein S11 [Escherichia coli TA143]
 gi|331670126|ref|ZP_08370965.1| 30S ribosomal protein S11 [Escherichia coli TA271]
 gi|331674803|ref|ZP_08375560.1| 30S ribosomal protein S11 [Escherichia coli TA280]
 gi|331679366|ref|ZP_08380036.1| 30S ribosomal protein S11 [Escherichia coli H591]
 gi|331684939|ref|ZP_08385525.1| 30S ribosomal protein S11 [Escherichia coli H299]
 gi|67472358|sp|P0A7R9|RS11_ECOLI RecName: Full=30S ribosomal protein S11
 gi|67472359|sp|P0A7S0|RS11_ECOL6 RecName: Full=30S ribosomal protein S11
 gi|67472360|sp|P0A7S1|RS11_ECO57 RecName: Full=30S ribosomal protein S11
 gi|67472361|sp|P0A7S2|RS11_SHIFL RecName: Full=30S ribosomal protein S11
 gi|91207677|sp|Q31VX9|RS11_SHIBS RecName: Full=30S ribosomal protein S11
 gi|91207678|sp|Q32B54|RS11_SHIDS RecName: Full=30S ribosomal protein S11
 gi|91207679|sp|Q3YWW2|RS11_SHISS RecName: Full=30S ribosomal protein S11
 gi|123342434|sp|Q0T005|RS11_SHIF8 RecName: Full=30S ribosomal protein S11
 gi|123343549|sp|Q0TCG4|RS11_ECOL5 RecName: Full=30S ribosomal protein S11
 gi|123387795|sp|Q1R635|RS11_ECOUT RecName: Full=30S ribosomal protein S11
 gi|152060588|sp|A1AGI8|RS11_ECOK1 RecName: Full=30S ribosomal protein S11
 gi|166991577|sp|A7ZSI6|RS11_ECO24 RecName: Full=30S ribosomal protein S11
 gi|166991578|sp|A8A5A2|RS11_ECOHS RecName: Full=30S ribosomal protein S11
 gi|189040414|sp|B1IQ02|RS11_ECOLC RecName: Full=30S ribosomal protein S11
 gi|189040432|sp|A9MN70|RS11_SALAR RecName: Full=30S ribosomal protein S11
 gi|226708363|sp|B7MCR3|RS11_ECO45 RecName: Full=30S ribosomal protein S11
 gi|226708364|sp|B5YT16|RS11_ECO5E RecName: Full=30S ribosomal protein S11
 gi|226708365|sp|B7NLL7|RS11_ECO7I RecName: Full=30S ribosomal protein S11
 gi|226708366|sp|B7M103|RS11_ECO8A RecName: Full=30S ribosomal protein S11
 gi|226708367|sp|B1X6E9|RS11_ECODH RecName: Full=30S ribosomal protein S11
 gi|226708368|sp|B7NDR9|RS11_ECOLU RecName: Full=30S ribosomal protein S11
 gi|226708369|sp|B6I211|RS11_ECOSE RecName: Full=30S ribosomal protein S11
 gi|226708370|sp|B1LHB1|RS11_ECOSM RecName: Full=30S ribosomal protein S11
 gi|226708372|sp|B7LRR4|RS11_ESCF3 RecName: Full=30S ribosomal protein S11
 gi|226708417|sp|B2U2R6|RS11_SHIB3 RecName: Full=30S ribosomal protein S11
 gi|254765383|sp|B7UK21|RS11_ECO27 RecName: Full=30S ribosomal protein S11
 gi|254765384|sp|B7LHZ9|RS11_ECO55 RecName: Full=30S ribosomal protein S11
 gi|254765385|sp|B7N182|RS11_ECO81 RecName: Full=30S ribosomal protein S11
 gi|259494622|sp|C4ZUF2|RS11_ECOBW RecName: Full=30S ribosomal protein S11
 gi|116666558|pdb|1VS5|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|116666610|pdb|1VS7|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|256032354|pdb|3E1A|C Chain C, Structure Of The 30s Subunit And The Trnas Of E. Coli
           Ribosome In Pre-Accommodation State
 gi|256032411|pdb|3E1C|C Chain C, Structure Of The 30s Subunit And The Trnas Of E. Coli
           Ribosome In Post-Accommodation State
 gi|257097332|pdb|3I1M|K Chain K, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097384|pdb|3I1O|K Chain K, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097436|pdb|3I1Q|K Chain K, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097490|pdb|3I1S|K Chain K, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097544|pdb|3I1Z|K Chain K, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097599|pdb|3I21|K Chain K, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|290560317|pdb|3KC4|K Chain K, Ribosome-Secy Complex. This Entry 3kc4 Contains 30s
           Ribosomal Subnit. The 50s Ribosomal Subunit Can Be Found
           In Pdb Entry 3kcr
 gi|308198697|pdb|3OR9|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 30s Subunit Of The First
           70s Ribosome.
 gi|308198718|pdb|3ORA|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 gi|326634289|pdb|3IZV|O Chain O, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Small Subunit Of A Ribosome Programmed With A
           Near-Cognate Codon, AT-Site Trna, P-Site Trna, Mrna And
           Ef-Tu
 gi|326634314|pdb|3IZW|O Chain O, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding.This Entry Contains The
           Small Subunit Of A Ribosome Programmed With A Cognate
           Codon, AT-Site Trna, P-Site Trna, Mrna And Ef-Tu
 gi|12517926|gb|AAG58418.1|AE005556_11 30S ribosomal subunit protein S11 [Escherichia coli O157:H7 str.
           EDL933]
 gi|26110310|gb|AAN82496.1|AE016767_256 30S ribosomal protein S11 [Escherichia coli CFT073]
 gi|42797|emb|CAA26393.1| unnamed protein product [Escherichia coli]
 gi|606232|gb|AAA58095.1| 30S ribosomal subunit protein S11 [Escherichia coli str. K-12
           substr. MG1655]
 gi|1789692|gb|AAC76322.1| 30S ribosomal subunit protein S11 [Escherichia coli str. K-12
           substr. MG1655]
 gi|13363635|dbj|BAB37585.1| 30S ribosomal subunit protein S11 [Escherichia coli O157:H7 str.
           Sakai]
 gi|24053771|gb|AAN44792.1| 30S ribosomal subunit protein S11 [Shigella flexneri 2a str. 301]
 gi|30043664|gb|AAP19384.1| 30S ribosomal subunit protein S11 [Shigella flexneri 2a str. 2457T]
 gi|73857293|gb|AAZ90000.1| 30S ribosomal subunit protein S11 [Shigella sonnei Ss046]
 gi|81242741|gb|ABB63451.1| 30S ribosomal subunit protein S11 [Shigella dysenteriae Sd197]
 gi|81247071|gb|ABB67779.1| 30S ribosomal subunit protein S11 [Shigella boydii Sb227]
 gi|85676744|dbj|BAE77994.1| 30S ribosomal subunit protein S11 [Escherichia coli str. K12
           substr. W3110]
 gi|91074298|gb|ABE09179.1| 30S ribosomal subunit protein S11 [Escherichia coli UTI89]
 gi|110345128|gb|ABG71365.1| 30S ribosomal protein S11 [Escherichia coli 536]
 gi|110616693|gb|ABF05360.1| 30S ribosomal subunit protein S11 [Shigella flexneri 5 str. 8401]
 gi|115514703|gb|ABJ02778.1| 30S ribosomal subunit protein S11 [Escherichia coli APEC O1]
 gi|157068451|gb|ABV07706.1| ribosomal protein S11 [Escherichia coli HS]
 gi|157078156|gb|ABV17864.1| ribosomal protein S11 [Escherichia coli E24377A]
 gi|160867377|gb|ABX24000.1| hypothetical protein SARI_04211 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|169753395|gb|ACA76094.1| ribosomal protein S11 [Escherichia coli ATCC 8739]
 gi|169890652|gb|ACB04359.1| 30S ribosomal subunit protein S11 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170121548|gb|EDS90479.1| ribosomal protein S11 [Escherichia albertii TW07627]
 gi|170517536|gb|ACB15714.1| ribosomal protein S11 [Escherichia coli SMS-3-5]
 gi|187427081|gb|ACD06355.1| ribosomal protein S11 [Shigella boydii CDC 3083-94]
 gi|187767004|gb|EDU30848.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4196]
 gi|188013839|gb|EDU51961.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4113]
 gi|188491267|gb|EDU66370.1| ribosomal protein S11 [Escherichia coli 53638]
 gi|188998854|gb|EDU67840.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4076]
 gi|189354696|gb|EDU73115.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4401]
 gi|189361729|gb|EDU80148.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4486]
 gi|189365125|gb|EDU83541.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4501]
 gi|189374191|gb|EDU92607.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC869]
 gi|189375347|gb|EDU93763.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC508]
 gi|190900652|gb|EDV60452.1| ribosomal protein S11 [Escherichia coli B7A]
 gi|190905259|gb|EDV64897.1| ribosomal protein S11 [Escherichia coli F11]
 gi|192925880|gb|EDV80530.1| ribosomal protein S11 [Escherichia coli E22]
 gi|192955124|gb|EDV85618.1| ribosomal protein S11 [Escherichia coli E110019]
 gi|194411680|gb|EDX28007.1| ribosomal protein S11 [Escherichia coli B171]
 gi|194416681|gb|EDX32812.1| ribosomal protein S11 [Shigella dysenteriae 1012]
 gi|194421063|gb|EDX37092.1| ribosomal protein S11 [Escherichia coli 101-1]
 gi|208728597|gb|EDZ78198.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4206]
 gi|208733165|gb|EDZ81852.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4045]
 gi|208738672|gb|EDZ86354.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4042]
 gi|209159481|gb|ACI36914.1| ribosomal protein S11 [Escherichia coli O157:H7 str. EC4115]
 gi|209757268|gb|ACI76946.1| 30S ribosomal subunit protein S11 [Escherichia coli]
 gi|209757270|gb|ACI76947.1| 30S ribosomal subunit protein S11 [Escherichia coli]
 gi|209757272|gb|ACI76948.1| 30S ribosomal subunit protein S11 [Escherichia coli]
 gi|209757274|gb|ACI76949.1| 30S ribosomal subunit protein S11 [Escherichia coli]
 gi|209757276|gb|ACI76950.1| 30S ribosomal subunit protein S11 [Escherichia coli]
 gi|209914022|dbj|BAG79096.1| 30S ribosomal protein S11 [Escherichia coli SE11]
 gi|215266669|emb|CAS11108.1| 30S ribosomal subunit protein S11 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217320754|gb|EEC29178.1| ribosomal protein S11 [Escherichia coli O157:H7 str. TW14588]
 gi|218353722|emb|CAV00000.1| 30S ribosomal subunit protein S11 [Escherichia coli 55989]
 gi|218358114|emb|CAQ90761.1| 30S ribosomal subunit protein S11 [Escherichia fergusonii ATCC
           35469]
 gi|218362623|emb|CAR00249.1| 30S ribosomal subunit protein S11 [Escherichia coli IAI1]
 gi|218367128|emb|CAR04902.1| 30S ribosomal subunit protein S11 [Escherichia coli S88]
 gi|218372046|emb|CAR19906.1| 30S ribosomal subunit protein S11 [Escherichia coli IAI39]
 gi|218429148|emb|CAR10100.2| 30S ribosomal subunit protein S11 [Escherichia coli ED1a]
 gi|218434002|emb|CAR14919.1| 30S ribosomal subunit protein S11 [Escherichia coli UMN026]
 gi|222035006|emb|CAP77749.1| 30S ribosomal protein S11 [Escherichia coli LF82]
 gi|226838964|gb|EEH70987.1| ribosomal protein S11 [Escherichia sp. 1_1_43]
 gi|226902291|gb|EEH88550.1| 30S ribosomal subunit protein S11 [Escherichia sp. 3_2_53FAA]
 gi|227839573|gb|EEJ50039.1| 30S ribosomal protein S11 [Escherichia coli 83972]
 gi|238859785|gb|ACR61783.1| 30S ribosomal subunit protein S11 [Escherichia coli BW2952]
 gi|242378824|emb|CAQ33616.1| 30S ribosomal subunit protein S11, subunit of 30S ribosomal subunit
           and ribosome [Escherichia coli BL21(DE3)]
 gi|253322923|gb|ACT27525.1| ribosomal protein S11 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975126|gb|ACT40797.1| 30S ribosomal protein S11 [Escherichia coli B str. REL606]
 gi|253979282|gb|ACT44952.1| 30S ribosomal protein S11 [Escherichia coli BL21(DE3)]
 gi|254594634|gb|ACT73995.1| 30S ribosomal subunit protein S11 [Escherichia coli O157:H7 str.
           TW14359]
 gi|257756067|dbj|BAI27569.1| 30S ribosomal subunit protein S11 [Escherichia coli O26:H11 str.
           11368]
 gi|257761242|dbj|BAI32739.1| 30S ribosomal subunit protein S11 [Escherichia coli O103:H2 str.
           12009]
 gi|257766396|dbj|BAI37891.1| 30S ribosomal subunit protein S11 [Escherichia coli O111:H- str.
           11128]
 gi|260447684|gb|ACX38106.1| ribosomal protein S11 [Escherichia coli DH1]
 gi|281602662|gb|ADA75646.1| 30S ribosomal protein S11 [Shigella flexneri 2002017]
 gi|282951521|emb|CBG91220.1| 30S ribosomal subunit protein S11 [Citrobacter rodentium ICC168]
 gi|284923303|emb|CBG36397.1| 30S ribosomal subunit protein S11 [Escherichia coli 042]
 gi|290764528|gb|ADD58489.1| 30S ribosomal protein S11 [Escherichia coli O55:H7 str. CB9615]
 gi|291088823|gb|EFE21384.1| 30S ribosomal protein S11 [Edwardsiella tarda ATCC 23685]
 gi|291321742|gb|EFE61173.1| 30S ribosomal protein S11 [Escherichia coli B088]
 gi|291425705|gb|EFE98739.1| 30S ribosomal protein S11 [Escherichia coli FVEC1412]
 gi|291431292|gb|EFF04277.1| 30S ribosomal protein S11 [Escherichia coli B185]
 gi|291468363|gb|EFF10856.1| 30S ribosomal protein S11 [Escherichia coli B354]
 gi|294492523|gb|ADE91279.1| ribosomal protein S11 [Escherichia coli IHE3034]
 gi|298276471|gb|EFI17989.1| 30S ribosomal protein S11 [Escherichia coli FVEC1302]
 gi|299881639|gb|EFI89850.1| 30S ribosomal protein S11 [Escherichia coli MS 196-1]
 gi|300301895|gb|EFJ58280.1| 30S ribosomal protein S11 [Escherichia coli MS 185-1]
 gi|300308987|gb|EFJ63507.1| 30S ribosomal protein S11 [Escherichia coli MS 200-1]
 gi|300318228|gb|EFJ68012.1| 30S ribosomal protein S11 [Escherichia coli MS 175-1]
 gi|300359477|gb|EFJ75347.1| 30S ribosomal protein S11 [Escherichia coli MS 198-1]
 gi|300399547|gb|EFJ83085.1| 30S ribosomal protein S11 [Escherichia coli MS 69-1]
 gi|300404419|gb|EFJ87957.1| 30S ribosomal protein S11 [Escherichia coli MS 84-1]
 gi|300409381|gb|EFJ92919.1| 30S ribosomal protein S11 [Escherichia coli MS 45-1]
 gi|300414533|gb|EFJ97843.1| 30S ribosomal protein S11 [Escherichia coli MS 115-1]
 gi|300421741|gb|EFK05052.1| 30S ribosomal protein S11 [Escherichia coli MS 182-1]
 gi|300453766|gb|EFK17386.1| 30S ribosomal protein S11 [Escherichia coli MS 116-1]
 gi|300459452|gb|EFK22945.1| 30S ribosomal protein S11 [Escherichia coli MS 21-1]
 gi|300460015|gb|EFK23508.1| 30S ribosomal protein S11 [Escherichia coli MS 187-1]
 gi|300524665|gb|EFK45734.1| 30S ribosomal protein S11 [Escherichia coli MS 119-7]
 gi|300532384|gb|EFK53446.1| 30S ribosomal protein S11 [Escherichia coli MS 107-1]
 gi|300839202|gb|EFK66962.1| 30S ribosomal protein S11 [Escherichia coli MS 124-1]
 gi|300848014|gb|EFK75774.1| 30S ribosomal protein S11 [Escherichia coli MS 78-1]
 gi|301077785|gb|EFK92591.1| 30S ribosomal protein S11 [Escherichia coli MS 146-1]
 gi|305850756|gb|EFM51213.1| 30S ribosomal protein S11 [Escherichia coli NC101]
 gi|306905473|gb|EFN36008.1| 30S ribosomal protein S11 [Escherichia coli W]
 gi|307555385|gb|ADN48160.1| 30S ribosomal subunit protein S11 [Escherichia coli ABU 83972]
 gi|307628332|gb|ADN72636.1| 30S ribosomal protein S11 [Escherichia coli UM146]
 gi|308121623|gb|EFO58885.1| 30S ribosomal protein S11 [Escherichia coli MS 145-7]
 gi|308746943|gb|ADO46695.1| 30S ribosomal protein S11 [Enterobacter cloacae SCF1]
 gi|308926739|gb|EFP72215.1| ribosomal S11 family protein [Shigella dysenteriae 1617]
 gi|309703709|emb|CBJ03050.1| 30S ribosomal subunit protein S11 [Escherichia coli ETEC H10407]
 gi|310334819|gb|EFQ01024.1| ribosomal S11 family protein [Escherichia coli 1827-70]
 gi|312287203|gb|EFR15113.1| ribosomal S11 family protein [Escherichia coli 2362-75]
 gi|312947848|gb|ADR28675.1| 30S ribosomal protein S11 [Escherichia coli O83:H1 str. NRG 857C]
 gi|313647393|gb|EFS11845.1| ribosomal S11 family protein [Shigella flexneri 2a str. 2457T]
 gi|315062589|gb|ADT76916.1| 30S ribosomal subunit protein S11 [Escherichia coli W]
 gi|315137872|dbj|BAJ45031.1| 30S ribosomal protein S11 [Escherichia coli DH1]
 gi|315255881|gb|EFU35849.1| 30S ribosomal protein S11 [Escherichia coli MS 85-1]
 gi|315284627|gb|EFU44072.1| 30S ribosomal protein S11 [Escherichia coli MS 110-3]
 gi|315292385|gb|EFU51737.1| 30S ribosomal protein S11 [Escherichia coli MS 153-1]
 gi|315298596|gb|EFU57851.1| 30S ribosomal protein S11 [Escherichia coli MS 16-3]
 gi|315617099|gb|EFU97709.1| ribosomal S11 family protein [Escherichia coli 3431]
 gi|320173941|gb|EFW49117.1| 30S ribosomal protein S11 [Shigella dysenteriae CDC 74-1112]
 gi|320182705|gb|EFW57591.1| 30S ribosomal protein S11 [Shigella boydii ATCC 9905]
 gi|320187018|gb|EFW61730.1| 30S ribosomal protein S11 [Shigella flexneri CDC 796-83]
 gi|320191669|gb|EFW66319.1| 30S ribosomal protein S11 [Escherichia coli O157:H7 str. EC1212]
 gi|320195389|gb|EFW70016.1| 30S ribosomal protein S11 [Escherichia coli WV_060327]
 gi|320199484|gb|EFW74074.1| 30S ribosomal protein S11 [Escherichia coli EC4100B]
 gi|320639602|gb|EFX09196.1| 30S ribosomal protein S11 [Escherichia coli O157:H7 str. G5101]
 gi|320645100|gb|EFX14116.1| 30S ribosomal protein S11 [Escherichia coli O157:H- str. 493-89]
 gi|320650411|gb|EFX18877.1| 30S ribosomal protein S11 [Escherichia coli O157:H- str. H 2687]
 gi|320655936|gb|EFX23856.1| 30S ribosomal protein S11 [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320661388|gb|EFX28803.1| 30S ribosomal protein S11 [Escherichia coli O55:H7 str. USDA 5905]
 gi|320666410|gb|EFX33393.1| 30S ribosomal protein S11 [Escherichia coli O157:H7 str. LSU-61]
 gi|323154135|gb|EFZ40338.1| ribosomal S11 family protein [Escherichia coli EPECa14]
 gi|323162976|gb|EFZ48811.1| ribosomal protein S11 family protein [Escherichia coli E128010]
 gi|323164861|gb|EFZ50652.1| ribosomal S11 family protein [Shigella sonnei 53G]
 gi|323173933|gb|EFZ59561.1| ribosomal protein S11 family protein [Escherichia coli LT-68]
 gi|323179167|gb|EFZ64741.1| ribosomal protein S11 family protein [Escherichia coli 1180]
 gi|323182775|gb|EFZ68176.1| ribosomal protein S11 family protein [Escherichia coli 1357]
 gi|323189098|gb|EFZ74382.1| ribosomal protein S11 family protein [Escherichia coli RN587/1]
 gi|323376824|gb|ADX49092.1| 30S ribosomal protein S11 [Escherichia coli KO11]
 gi|323934504|gb|EGB30912.1| 30S ribosomal protein S11 [Escherichia coli E1520]
 gi|323939281|gb|EGB35493.1| 30S ribosomal protein S11 [Escherichia coli E482]
 gi|323944282|gb|EGB40358.1| 30S ribosomal protein S11 [Escherichia coli H120]
 gi|323950211|gb|EGB46093.1| 30S ribosomal protein S11 [Escherichia coli H252]
 gi|323954580|gb|EGB50363.1| 30S ribosomal protein S11 [Escherichia coli H263]
 gi|323959552|gb|EGB55205.1| 30S ribosomal protein S11 [Escherichia coli H489]
 gi|323966259|gb|EGB61694.1| 30S ribosomal protein S11 [Escherichia coli M863]
 gi|323970101|gb|EGB65375.1| 30S ribosomal protein S11 [Escherichia coli TA007]
 gi|323974750|gb|EGB69863.1| 30S ribosomal protein S11 [Escherichia coli TW10509]
 gi|324009032|gb|EGB78251.1| 30S ribosomal protein S11 [Escherichia coli MS 57-2]
 gi|324014914|gb|EGB84133.1| 30S ribosomal protein S11 [Escherichia coli MS 60-1]
 gi|324017884|gb|EGB87103.1| 30S ribosomal protein S11 [Escherichia coli MS 117-3]
 gi|324111976|gb|EGC05955.1| 30S ribosomal protein S11 [Escherichia fergusonii B253]
 gi|324116313|gb|EGC10233.1| 30S ribosomal protein S11 [Escherichia coli E1167]
 gi|325498866|gb|EGC96725.1| 30S ribosomal protein S11 [Escherichia fergusonii ECD227]
 gi|326342545|gb|EGD66319.1| 30S ribosomal protein S11 [Escherichia coli O157:H7 str. 1044]
 gi|326344532|gb|EGD68281.1| 30S ribosomal protein S11 [Escherichia coli O157:H7 str. 1125]
 gi|327250945|gb|EGE62638.1| ribosomal protein S11 family protein [Escherichia coli STEC_7v]
 gi|330909341|gb|EGH37855.1| SSU ribosomal protein S11p (S14e) [Escherichia coli AA86]
 gi|331036287|gb|EGI08513.1| 30S ribosomal protein S11 [Escherichia coli H736]
 gi|331041592|gb|EGI13736.1| 30S ribosomal protein S11 [Escherichia coli M605]
 gi|331046905|gb|EGI18983.1| 30S ribosomal protein S11 [Escherichia coli M718]
 gi|331052802|gb|EGI24835.1| 30S ribosomal protein S11 [Escherichia coli TA206]
 gi|331057420|gb|EGI29406.1| 30S ribosomal protein S11 [Escherichia coli TA143]
 gi|331062188|gb|EGI34108.1| 30S ribosomal protein S11 [Escherichia coli TA271]
 gi|331067712|gb|EGI39110.1| 30S ribosomal protein S11 [Escherichia coli TA280]
 gi|331072538|gb|EGI43863.1| 30S ribosomal protein S11 [Escherichia coli H591]
 gi|331077310|gb|EGI48522.1| 30S ribosomal protein S11 [Escherichia coli H299]
 gi|332085446|gb|EGI90612.1| ribosomal protein S11 family protein [Shigella boydii 5216-82]
 gi|332090513|gb|EGI95611.1| ribosomal protein S11 family protein [Shigella boydii 3594-74]
 gi|332104204|gb|EGJ07550.1| 30S ribosomal subunit protein S11 [Shigella sp. D9]
          Length = 129

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|114561359|ref|YP_748872.1| 30S ribosomal protein S11 [Shewanella frigidimarina NCIMB 400]
 gi|122301095|sp|Q089N1|RS11_SHEFN RecName: Full=30S ribosomal protein S11
 gi|114332652|gb|ABI70034.1| SSU ribosomal protein S11P [Shewanella frigidimarina NCIMB 400]
          Length = 130

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 92/130 (70%), Gaps = 1/130 (0%)

Query: 1   MPKSPSR-IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           M K PSR  R R RK +  G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++
Sbjct: 1   MAKVPSRSPRKRVRKQVADGMAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKST 60

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           PFAAQVA +     AQ++G+ +LEV V G G GR+SA+RAL A+G+ I +I DVT I HN
Sbjct: 61  PFAAQVAAERAGIAAQDYGVKNLEVFVKGPGPGRESAIRALNAVGYKITNITDVTPIPHN 120

Query: 120 GCRPRKRRRI 129
           GCRP K+RR+
Sbjct: 121 GCRPPKKRRV 130


>gi|16272742|ref|NP_438960.1| 30S ribosomal protein S11 [Haemophilus influenzae Rd KW20]
 gi|1173178|sp|P44379|RS11_HAEIN RecName: Full=30S ribosomal protein S11
 gi|1573811|gb|AAC22459.1| ribosomal protein S11 (rpS11) [Haemophilus influenzae Rd KW20]
          Length = 129

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R +K +V G  H+ ++FNNT +TITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKTPVRARKRVKKQVVDGVRHIHASFNNTIVTITDRQGNALAWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   +  G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEIVKEFGLKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|157960036|ref|YP_001500070.1| 30S ribosomal protein S11 [Shewanella pealeana ATCC 700345]
 gi|167626017|ref|YP_001676311.1| 30S ribosomal protein S11 [Shewanella halifaxensis HAW-EB4]
 gi|212634852|ref|YP_002311377.1| 30S ribosomal protein S11 [Shewanella piezotolerans WP3]
 gi|189040436|sp|B0TLZ0|RS11_SHEHH RecName: Full=30S ribosomal protein S11
 gi|189040437|sp|A8GYZ8|RS11_SHEPA RecName: Full=30S ribosomal protein S11
 gi|226708415|sp|B8CNF6|RS11_SHEPW RecName: Full=30S ribosomal protein S11
 gi|157845036|gb|ABV85535.1| ribosomal protein S11 [Shewanella pealeana ATCC 700345]
 gi|167356039|gb|ABZ78652.1| ribosomal protein S11 [Shewanella halifaxensis HAW-EB4]
 gi|212556336|gb|ACJ28790.1| Ribosomal protein S11 [Shewanella piezotolerans WP3]
          Length = 130

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 92/130 (70%), Gaps = 1/130 (0%)

Query: 1   MPKSPSR-IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           M K PSR  R R RK +  G AH+ ++FNNT ITITD  GN ++W++    GF GSRK++
Sbjct: 1   MAKVPSRSPRKRVRKQVADGMAHIHASFNNTIITITDRQGNALSWATSGGSGFRGSRKST 60

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           PFAAQVA +     AQ++G+ +LEV V G G GR+SA+RAL ++G+ I +I DVT I HN
Sbjct: 61  PFAAQVAAERAGTAAQDYGVKNLEVFVKGPGPGRESAIRALNSVGYKITNITDVTPIPHN 120

Query: 120 GCRPRKRRRI 129
           GCRP K+RR+
Sbjct: 121 GCRPPKKRRV 130


>gi|301628937|ref|XP_002943605.1| PREDICTED: 30S ribosomal protein S11-like [Xenopus (Silurana)
           tropicalis]
          Length = 134

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 71/134 (52%), Positives = 94/134 (70%), Gaps = 5/134 (3%)

Query: 1   MPKSPS-----RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGS 55
           M KSP+     R+R + RKNI  G AHV ++FNNT ITITD  GN ++W+S    GF GS
Sbjct: 1   MAKSPANNAAARVRKKVRKNISDGIAHVHASFNNTIITITDRQGNALSWASSGGQGFKGS 60

Query: 56  RKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTM 115
           RK++PFAAQVA++     A   G+ +L+V++ G G GR+S++RAL A+G  I SI DVT 
Sbjct: 61  RKSTPFAAQVASEVAGRAAMEQGIKNLDVEIKGPGPGRESSVRALGALGIRITSISDVTP 120

Query: 116 IAHNGCRPRKRRRI 129
           + HNGCRP+KRRRI
Sbjct: 121 VPHNGCRPQKRRRI 134


>gi|153952887|ref|YP_001393652.1| 30S ribosomal protein S11 [Clostridium kluyveri DSM 555]
 gi|219853552|ref|YP_002470674.1| hypothetical protein CKR_0209 [Clostridium kluyveri NBRC 12016]
 gi|189040409|sp|A5N4S3|RS11_CLOK5 RecName: Full=30S ribosomal protein S11
 gi|254765376|sp|B9DYD5|RS11_CLOK1 RecName: Full=30S ribosomal protein S11
 gi|146345768|gb|EDK32304.1| RpsK [Clostridium kluyveri DSM 555]
 gi|219567276|dbj|BAH05260.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 132

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +ERKN+  G AH+ STFNN+ +TITD  GNT++W+S   +GF GSRK++PFAAQ+A +
Sbjct: 12  RKKERKNVEHGCAHIRSTFNNSIVTITDAAGNTLSWASAGGLGFRGSRKSTPFAAQMAAE 71

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ S+EV V G G+GR++A+R+L+A G  +  I DVT I HNGCRP KRRR
Sbjct: 72  TSAKAAMEHGLKSIEVYVKGPGSGREAAIRSLQAAGLEVTLIKDVTPIPHNGCRPPKRRR 131

Query: 129 I 129
           +
Sbjct: 132 V 132


>gi|157377428|ref|YP_001476028.1| 30S ribosomal protein S11 [Shewanella sediminis HAW-EB3]
 gi|189040438|sp|A8G1C7|RS11_SHESH RecName: Full=30S ribosomal protein S11
 gi|157319802|gb|ABV38900.1| ribosomal protein S11 [Shewanella sediminis HAW-EB3]
          Length = 130

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 92/130 (70%), Gaps = 1/130 (0%)

Query: 1   MPKSPSR-IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           M K PSR  R R RK +  G AH+ ++FNNT ITITD  GN ++W++    GF GSRK++
Sbjct: 1   MAKVPSRSPRKRVRKQVADGMAHIHASFNNTIITITDRQGNALSWATSGGSGFRGSRKST 60

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           PFAAQVA +     AQ++G+ +LEV V G G GR+SA+RAL ++G+ I +I DVT I HN
Sbjct: 61  PFAAQVAAERAGVAAQDYGVKNLEVFVKGPGPGRESAIRALNSVGYKITNITDVTPIPHN 120

Query: 120 GCRPRKRRRI 129
           GCRP K+RR+
Sbjct: 121 GCRPPKKRRV 130


>gi|123444075|ref|YP_001008045.1| 30S ribosomal protein S11 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238788889|ref|ZP_04632679.1| hypothetical protein yfred0001_26960 [Yersinia frederiksenii ATCC
           33641]
 gi|332163238|ref|YP_004299815.1| 30S ribosomal protein S11 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|152060832|sp|A1JS03|RS11_YERE8 RecName: Full=30S ribosomal protein S11
 gi|122091036|emb|CAL13919.1| 30S ribosomal protein S11 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238722916|gb|EEQ14566.1| hypothetical protein yfred0001_26960 [Yersinia frederiksenii ATCC
           33641]
 gi|318607722|emb|CBY29220.1| SSU ribosomal protein S11p (S14e) [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325667468|gb|ADZ44112.1| 30S ribosomal protein S11 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861831|emb|CBX72002.1| 30S ribosomal protein S11 [Yersinia enterocolitica W22703]
          Length = 129

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPIRARKRVRKTVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|325981828|ref|YP_004294230.1| 30S ribosomal protein S11 [Nitrosomonas sp. AL212]
 gi|325531347|gb|ADZ26068.1| 30S ribosomal protein S11 [Nitrosomonas sp. AL212]
          Length = 129

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 93/129 (72%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  SR+R + +KN+  G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MVKITSRVRKKIKKNVSEGIAHIHASFNNTIVTITDRQGNALSWATSGGAGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A ++ S  A + G+ +LEV+V G G GRDSA+RAL + GF I SI DVT + HNG
Sbjct: 61  FAAQIAAENASKIAIDCGVKNLEVRVKGPGPGRDSAVRALNSAGFKITSISDVTPVPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RRI
Sbjct: 121 CRPPKKRRI 129


>gi|118602236|ref|YP_903451.1| 30S ribosomal protein S11 [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|152060816|sp|A1AVM3|RS11_RUTMC RecName: Full=30S ribosomal protein S11
 gi|118567175|gb|ABL01980.1| SSU ribosomal protein S11P [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 127

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 87/129 (67%), Gaps = 2/129 (1%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P+R   + +K I+ G AH+ +TFNNT + ITD HGN I WS+    GF GSRK++P
Sbjct: 1   MAKTPTR--KKSKKVIIDGIAHIHATFNNTIVMITDRHGNAICWSASGGSGFRGSRKSTP 58

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQV    C  KA   GM +LEV+V G G GRDSA+R L A G  I SI DVT I HNG
Sbjct: 59  FAAQVTAGSCGEKALAFGMKNLEVRVKGPGPGRDSAIRGLNAQGLKIQSITDVTPIPHNG 118

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 119 CRPSKKRRV 127


>gi|34499617|ref|NP_903832.1| 30S ribosomal protein S11 [Chromobacterium violaceum ATCC 12472]
 gi|59798830|sp|Q7NQH5|RS11_CHRVO RecName: Full=30S ribosomal protein S11
 gi|34105468|gb|AAQ61823.1| 30S ribosomal protein S11 [Chromobacterium violaceum ATCC 12472]
          Length = 131

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 89/123 (72%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R+R + RK++  G  HV ++FNNT ITITD  GN ++W++    GF GSRK++PFAAQVA
Sbjct: 9   RVRKKVRKSVSEGIVHVHASFNNTIITITDRQGNALSWATSGGAGFKGSRKSTPFAAQVA 68

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +     AQ +G+ +LEV++ G G GR+SA+RAL ++GF I SI DVT + HNGCRP K+
Sbjct: 69  AEHAGKVAQEYGVKNLEVRIKGPGPGRESAVRALNSLGFKITSISDVTPVPHNGCRPPKK 128

Query: 127 RRI 129
           RRI
Sbjct: 129 RRI 131


>gi|172056166|ref|YP_001812626.1| ribosomal protein S11 [Exiguobacterium sibiricum 255-15]
 gi|259494623|sp|B1YGX6|RS11_EXIS2 RecName: Full=30S ribosomal protein S11
 gi|171988687|gb|ACB59609.1| ribosomal protein S11 [Exiguobacterium sibiricum 255-15]
          Length = 131

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 66/127 (51%), Positives = 93/127 (73%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K   R + + +KNI SG  H+ STFNNT +TITD  GN I+W++   +GF GSRK++PFA
Sbjct: 5   KQNVRSKRKVKKNIESGIVHIRSTFNNTIVTITDMQGNAISWATAGNMGFKGSRKSTPFA 64

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A++  +  A ++GM ++EV V G GAGR++A+RAL+AIG  + +I DVT + HNGCR
Sbjct: 65  AQLASETAAKTAMDNGMRTVEVNVKGPGAGREAAIRALQAIGLEVTAIRDVTPVPHNGCR 124

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 125 PPKRRRV 131


>gi|281180332|dbj|BAI56662.1| 30S ribosomal protein S11 [Escherichia coli SE15]
          Length = 129

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCADVVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|260655358|ref|ZP_05860846.1| 30S ribosomal protein S11 [Jonquetella anthropi E3_33 E1]
 gi|260629806|gb|EEX48000.1| 30S ribosomal protein S11 [Jonquetella anthropi E3_33 E1]
          Length = 130

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 71/130 (54%), Positives = 92/130 (70%), Gaps = 1/130 (0%)

Query: 1   MPKSPSRI-RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           M KS +R  + +E+KNI SG AH+ STFNNT ++ITD  G  +AW+S   VGF G+RK++
Sbjct: 1   MAKSTARKGKRKEKKNISSGVAHIFSTFNNTIVSITDKGGALLAWASGGNVGFKGARKST 60

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           PFAAQVA+      AQ+ GM  ++V V G G GR+SA+RAL+AIG  + SI D T I HN
Sbjct: 61  PFAAQVASQQAGKVAQDQGMHEIDVVVKGPGPGRESAIRALQAIGLQVNSIKDETPIPHN 120

Query: 120 GCRPRKRRRI 129
           GCRP KRRR+
Sbjct: 121 GCRPPKRRRV 130


>gi|239996314|ref|ZP_04716838.1| 30S ribosomal protein S11 [Alteromonas macleodii ATCC 27126]
 gi|332142183|ref|YP_004427921.1| 30S ribosomal protein S11 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|226708324|sp|B4RT51|RS11_ALTMD RecName: Full=30S ribosomal protein S11
 gi|327552205|gb|AEA98923.1| 30S ribosomal protein S11 [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 130

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 67/130 (51%), Positives = 91/130 (70%), Gaps = 1/130 (0%)

Query: 1   MPKSPSR-IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           M K+P+R  R R ++ +  G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++
Sbjct: 1   MAKAPARSTRKRAKRQVADGMAHIHASFNNTIVTITDRSGNALAWATSGGSGFRGSRKST 60

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           PFAAQVA +     AQ +G+ +LEV V G G GR+SA+RAL A G+ I +I DVT I HN
Sbjct: 61  PFAAQVAAERAGVAAQEYGLKNLEVFVKGPGPGRESAIRALNATGYKITNITDVTPIPHN 120

Query: 120 GCRPRKRRRI 129
           GCRP K+RR+
Sbjct: 121 GCRPPKKRRV 130


>gi|304438881|ref|ZP_07398804.1| 30S ribosomal protein S11 [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304372547|gb|EFM26130.1| 30S ribosomal protein S11 [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 131

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 92/124 (74%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +++R RERKNI  G+AH+ S+FNNT +T+TD  GN I+W+S   +GF GSRK++PFAAQ 
Sbjct: 8   TKVRRRERKNIEKGQAHIASSFNNTMVTLTDMSGNVISWASAGQLGFRGSRKSTPFAAQE 67

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A    + KA+ HG+ S+EV V G G+GR++A+R+L+A G  +  I DVT I HNGCRP K
Sbjct: 68  AAQTAAEKAKEHGLKSVEVYVKGPGSGREAAIRSLQATGLEVTMIKDVTPIPHNGCRPPK 127

Query: 126 RRRI 129
           RRR+
Sbjct: 128 RRRV 131


>gi|319760352|ref|YP_004124290.1| 30S ribosomal protein S11 [Candidatus Blochmannia vafer str. BVAF]
 gi|318039066|gb|ADV33616.1| 30S ribosomal protein S11 [Candidatus Blochmannia vafer str. BVAF]
          Length = 130

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 70/130 (53%), Positives = 92/130 (70%), Gaps = 1/130 (0%)

Query: 1   MPKSPS-RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           M KS S R R R +K I  G AH+ ++FNNT +TI+D  GNT+ W++    GF GSRK++
Sbjct: 1   MIKSSSLRSRKRVKKQITDGIAHIHASFNNTIVTISDRQGNTLGWATSGGSGFRGSRKST 60

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           PFAAQ+A + C+   Q +G+ +LEV V G G GR+SA+RAL A GF I+SI DVT I HN
Sbjct: 61  PFAAQIAAERCADIVQEYGVKNLEVMVKGPGPGRESAVRALNASGFNIISITDVTPIPHN 120

Query: 120 GCRPRKRRRI 129
           GCRP K+RR+
Sbjct: 121 GCRPSKKRRV 130


>gi|253577206|ref|ZP_04854526.1| 30S ribosomal protein S11 [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251843450|gb|EES71478.1| 30S ribosomal protein S11 [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 131

 Score =  138 bits (347), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 94/128 (73%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK   R + R+RKNI SG AH+ STFNNT +TITDPHGN I+W+S   +GF GSRK++PF
Sbjct: 4   PKKVVRTKRRDRKNIESGVAHIRSTFNNTIVTITDPHGNAISWASSGGLGFKGSRKSTPF 63

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ+A +  +  A  HGM ++EV V G GAGR++A+R+L+A G  +  I DVT I HNGC
Sbjct: 64  AAQMAAESAAKAAMEHGMKTVEVMVKGPGAGREAAIRSLQAAGLEVNMIKDVTPIPHNGC 123

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 124 RPPKRRRV 131


>gi|239825719|ref|YP_002948343.1| 30S ribosomal protein S11 [Geobacillus sp. WCH70]
 gi|295401894|ref|ZP_06811857.1| 30S ribosomal protein S11 [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312109287|ref|YP_003987603.1| 30S ribosomal protein S11 [Geobacillus sp. Y4.1MC1]
 gi|259494625|sp|C5D3U3|RS11_GEOSW RecName: Full=30S ribosomal protein S11
 gi|239806012|gb|ACS23077.1| ribosomal protein S11 [Geobacillus sp. WCH70]
 gi|294976024|gb|EFG51639.1| 30S ribosomal protein S11 [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311214388|gb|ADP72992.1| 30S ribosomal protein S11 [Geobacillus sp. Y4.1MC1]
          Length = 129

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 72/121 (59%), Positives = 91/121 (75%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R RKNI +G AH+ STFNNT +TITD HGNTIAWSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVRKNIETGIAHIRSTFNNTIVTITDVHGNTIAWSSAGALGFKGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  +  HGM ++EV V G GAGR++A+RAL+A G  I +I DVT I HNGCRP KRRR
Sbjct: 69  AAAKASMEHGMKTVEVNVKGPGAGREAAIRALQAAGLEITAIKDVTPIPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|229542178|ref|ZP_04431238.1| ribosomal protein S11 [Bacillus coagulans 36D1]
 gi|229326598|gb|EEN92273.1| ribosomal protein S11 [Bacillus coagulans 36D1]
          Length = 129

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 71/121 (58%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R RKNI SG AH+ STFNNT +TITD HGN +AWSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVRKNIESGVAHIRSTFNNTIVTITDVHGNAVAWSSAGALGFKGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  +  HGM SLEV V G GAGR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TAAKASMEHGMKSLEVTVKGPGAGREAAIRALQAAGLEVTAIKDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|117620332|ref|YP_854865.1| 30S ribosomal protein S11 [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|145300912|ref|YP_001143753.1| 30S ribosomal protein S11 [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|152060569|sp|A0KF43|RS11_AERHH RecName: Full=30S ribosomal protein S11
 gi|152060570|sp|A4SSY3|RS11_AERS4 RecName: Full=30S ribosomal protein S11
 gi|117561739|gb|ABK38687.1| ribosomal protein S11 [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|142853684|gb|ABO92005.1| ribosomal protein S11 [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 129

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 91/129 (70%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P+R R R +K +  G AHV ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKTPTRARKRVKKQVSDGIAHVHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     A+ +G+ +LEV V G G GR+S++RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERAGEIAKEYGVKNLEVMVKGPGPGRESSIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|85060233|ref|YP_455935.1| 30S ribosomal protein S11 [Sodalis glossinidius str. 'morsitans']
 gi|123752576|sp|Q2NQP5|RS11_SODGM RecName: Full=30S ribosomal protein S11
 gi|84780753|dbj|BAE75530.1| 30S ribosomal protein S11 [Sodalis glossinidius str. 'morsitans']
          Length = 129

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R +K +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPIRARKRVKKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEAVKEYGIKNLEVVVKGPGPGRESTVRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|91786409|ref|YP_547361.1| 30S ribosomal protein S11 [Polaromonas sp. JS666]
 gi|123165433|sp|Q12G79|RS11_POLSJ RecName: Full=30S ribosomal protein S11
 gi|91695634|gb|ABE42463.1| SSU ribosomal protein S11P [Polaromonas sp. JS666]
          Length = 134

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 71/134 (52%), Positives = 94/134 (70%), Gaps = 5/134 (3%)

Query: 1   MPKSPS-----RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGS 55
           M KSPS     R+R + RKN+  G AHV ++FNNT ITITD  GN ++W+S    GF GS
Sbjct: 1   MAKSPSNNAAQRVRKKVRKNVADGIAHVHASFNNTIITITDRQGNALSWASSGGQGFKGS 60

Query: 56  RKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTM 115
           RK++PFAAQVA++     A   G+ +L+V++ G G GR+S++RAL A+G  I SI DVT 
Sbjct: 61  RKSTPFAAQVASEVAGRAAIEQGIKNLDVEIKGPGPGRESSVRALGALGIRINSIADVTP 120

Query: 116 IAHNGCRPRKRRRI 129
           + HNGCRP+KRRRI
Sbjct: 121 VPHNGCRPQKRRRI 134


>gi|160896493|ref|YP_001562075.1| 30S ribosomal protein S11 [Delftia acidovorans SPH-1]
 gi|226708357|sp|A9BRX3|RS11_DELAS RecName: Full=30S ribosomal protein S11
 gi|160362077|gb|ABX33690.1| ribosomal protein S11 [Delftia acidovorans SPH-1]
          Length = 134

 Score =  137 bits (346), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 71/134 (52%), Positives = 94/134 (70%), Gaps = 5/134 (3%)

Query: 1   MPKSPS-----RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGS 55
           M KSP+     R+R + RKNI  G AHV ++FNNT ITITD  GN ++W+S    GF GS
Sbjct: 1   MAKSPANNAAQRVRKKVRKNISDGIAHVHASFNNTIITITDRQGNALSWASSGGQGFKGS 60

Query: 56  RKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTM 115
           RK++PFAAQVA++     A   G+ +L+V++ G G GR+S++RAL A+G  I SI DVT 
Sbjct: 61  RKSTPFAAQVASEVAGRAAIEQGIKNLDVEIKGPGPGRESSVRALGALGIRITSIADVTP 120

Query: 116 IAHNGCRPRKRRRI 129
           + HNGCRP+KRRRI
Sbjct: 121 VPHNGCRPQKRRRI 134


>gi|332107891|gb|EGJ09115.1| 30S ribosomal protein S11 [Rubrivivax benzoatilyticus JA2]
          Length = 134

 Score =  137 bits (346), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 93/134 (69%), Gaps = 5/134 (3%)

Query: 1   MPKSP-----SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGS 55
           M KSP      R+  + RKNI  G AHV ++FNNT ITITD  G ++AW+S    GF GS
Sbjct: 1   MAKSPVNNAARRVSKKIRKNIADGIAHVHASFNNTIITITDRQGGSLAWASSGGQGFKGS 60

Query: 56  RKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTM 115
           RK++PFAAQVA ++    AQ  G+ +L+V++ G G GR+S++RAL ++G  I SI DVT 
Sbjct: 61  RKSTPFAAQVAAENAGRAAQEQGIKNLDVRIKGPGPGRESSVRALASLGIRITSISDVTP 120

Query: 116 IAHNGCRPRKRRRI 129
           + HNGCRP+KRRRI
Sbjct: 121 VPHNGCRPQKRRRI 134


>gi|315649672|ref|ZP_07902756.1| ribosomal protein S11 [Paenibacillus vortex V453]
 gi|315274860|gb|EFU38236.1| ribosomal protein S11 [Paenibacillus vortex V453]
          Length = 131

 Score =  137 bits (346), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 94/128 (73%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK   R + R+RKNI SG AH+ STFNNT +TITDPHGN I+W+S   +GF GSRK++PF
Sbjct: 4   PKKVVRTKRRDRKNIESGVAHIRSTFNNTIVTITDPHGNAISWASSGGLGFKGSRKSTPF 63

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ+A +  +  A  HGM ++EV V G GAGR++A+R+L+A G  +  I DVT I HNGC
Sbjct: 64  AAQMAAESAAKAAMEHGMKAVEVMVKGPGAGREAAIRSLQAAGLEVNLIKDVTPIPHNGC 123

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 124 RPPKRRRV 131


>gi|304653871|ref|YP_003864093.1| 30S ribosomal protein S11 [Paenibacillus sp. Y412MC10]
 gi|329922032|ref|ZP_08277825.1| 30S ribosomal protein S11 [Paenibacillus sp. HGF5]
 gi|328942415|gb|EGG38679.1| 30S ribosomal protein S11 [Paenibacillus sp. HGF5]
          Length = 131

 Score =  137 bits (346), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 94/128 (73%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK   R + R+RKNI SG AH+ STFNNT +TITDPHGN I+W+S   +GF GSRK++PF
Sbjct: 4   PKKVVRTKRRDRKNIESGVAHIRSTFNNTIVTITDPHGNAISWASSGGLGFKGSRKSTPF 63

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ+A +  +  A  HGM ++EV V G GAGR++A+R+L+A G  +  I DVT I HNGC
Sbjct: 64  AAQMAAETAAKAAMEHGMKAVEVMVKGPGAGREAAIRSLQAAGLEVNLIKDVTPIPHNGC 123

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 124 RPPKRRRV 131


>gi|257866553|ref|ZP_05646206.1| ribosomal protein S11 [Enterococcus casseliflavus EC30]
 gi|257872931|ref|ZP_05652584.1| ribosomal protein S11 [Enterococcus casseliflavus EC10]
 gi|257876157|ref|ZP_05655810.1| ribosomal protein S11 [Enterococcus casseliflavus EC20]
 gi|325567352|ref|ZP_08144019.1| 30S ribosomal protein S11 [Enterococcus casseliflavus ATCC 12755]
 gi|257800511|gb|EEV29539.1| ribosomal protein S11 [Enterococcus casseliflavus EC30]
 gi|257807095|gb|EEV35917.1| ribosomal protein S11 [Enterococcus casseliflavus EC10]
 gi|257810323|gb|EEV39143.1| ribosomal protein S11 [Enterococcus casseliflavus EC20]
 gi|325158785|gb|EGC70931.1| 30S ribosomal protein S11 [Enterococcus casseliflavus ATCC 12755]
          Length = 129

 Score =  137 bits (346), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT + ITD HGN +AWSS   +GF GS+K++PFAAQ+A +
Sbjct: 9   KRRVKKNIEAGIAHIHSTFNNTIVMITDTHGNALAWSSAGSLGFKGSKKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ ++EV V G G+GR++A+R+L+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TATKAAMEHGLRTVEVTVKGPGSGREAAIRSLQAAGLEVSAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|121592836|ref|YP_984732.1| 30S ribosomal protein S11 [Acidovorax sp. JS42]
 gi|222109616|ref|YP_002551880.1| 30S ribosomal protein s11 [Acidovorax ebreus TPSY]
 gi|152060567|sp|A1W331|RS11_ACISJ RecName: Full=30S ribosomal protein S11
 gi|254765382|sp|B9MBW0|RS11_DIAST RecName: Full=30S ribosomal protein S11
 gi|120604916|gb|ABM40656.1| SSU ribosomal protein S11P [Acidovorax sp. JS42]
 gi|221729060|gb|ACM31880.1| ribosomal protein S11 [Acidovorax ebreus TPSY]
          Length = 134

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 71/134 (52%), Positives = 94/134 (70%), Gaps = 5/134 (3%)

Query: 1   MPKSPS-----RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGS 55
           M KSP+     R+R + RKNI  G AHV ++FNNT ITITD  GN ++W+S    GF GS
Sbjct: 1   MAKSPANNAAQRVRKKVRKNISDGIAHVHASFNNTIITITDRQGNALSWASSGGQGFKGS 60

Query: 56  RKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTM 115
           RK++PFAAQVA++     A   G+ +L+V++ G G GR+S++RAL A+G  I SI DVT 
Sbjct: 61  RKSTPFAAQVASEVAGRAAIEQGIKNLDVEIKGPGPGRESSVRALGALGIRITSISDVTP 120

Query: 116 IAHNGCRPRKRRRI 129
           + HNGCRP+KRRRI
Sbjct: 121 VPHNGCRPQKRRRI 134


>gi|171060595|ref|YP_001792944.1| 30S ribosomal protein S11 [Leptothrix cholodnii SP-6]
 gi|226708382|sp|B1Y8B3|RS11_LEPCP RecName: Full=30S ribosomal protein S11
 gi|170778040|gb|ACB36179.1| ribosomal protein S11 [Leptothrix cholodnii SP-6]
          Length = 134

 Score =  137 bits (345), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 92/134 (68%), Gaps = 5/134 (3%)

Query: 1   MPKSP-----SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGS 55
           M K+P      R+  + RKNI  G AHV ++FNNT ITITD  GN ++W+S    GF GS
Sbjct: 1   MAKAPVNNAARRVSKKVRKNIADGVAHVHASFNNTIITITDRQGNALSWASSGGQGFKGS 60

Query: 56  RKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTM 115
           RK++PFAAQVA +     AQ  G+ +L+VK+ G G GR+S++RAL ++G  I SI DVT 
Sbjct: 61  RKSTPFAAQVAAEVAGRAAQEQGIKNLDVKIKGPGPGRESSVRALASLGIRIASISDVTP 120

Query: 116 IAHNGCRPRKRRRI 129
           + HNGCRP+KRRRI
Sbjct: 121 VPHNGCRPQKRRRI 134


>gi|15612724|ref|NP_241027.1| 30S ribosomal protein S11 [Bacillus halodurans C-125]
 gi|6094146|sp|O50633|RS11_BACHD RecName: Full=30S ribosomal protein S11
 gi|2760184|dbj|BAA24193.1| ribosomal protein S11 [Bacillus halodurans]
 gi|4512430|dbj|BAA75297.1| rpsK homologue (identity of 82% to B. subtilis ) [Bacillus
           halodurans]
 gi|10172773|dbj|BAB03880.1| 30S ribosomal protein S11 [Bacillus halodurans C-125]
          Length = 129

 Score =  137 bits (345), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 95/129 (73%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +  + R+RKN+ +G AH+ STFNNT +TITDPHGN I+W+S   +GF GSRK++P
Sbjct: 1   MAKKTNTRKRRQRKNVETGVAHIRSTFNNTIVTITDPHGNAISWASAGALGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  +  A  HGM S+EV V G GAGR++A+R+L+A+G  +  I DVT + HNG
Sbjct: 61  FAAQMAAETAAKAAMEHGMKSIEVSVKGPGAGREAAIRSLQAVGLEVNMIKDVTPVPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|33594505|ref|NP_882149.1| 30S ribosomal protein S11 [Bordetella pertussis Tohama I]
 gi|33594776|ref|NP_882419.1| 30S ribosomal protein S11 [Bordetella parapertussis 12822]
 gi|33599048|ref|NP_886608.1| 30S ribosomal protein S11 [Bordetella bronchiseptica RB50]
 gi|187476572|ref|YP_784596.1| 30S ribosomal protein S11 [Bordetella avium 197N]
 gi|59798863|sp|Q7VTA7|RS11_BORPE RecName: Full=30S ribosomal protein S11
 gi|59798867|sp|Q7W2D1|RS11_BORPA RecName: Full=30S ribosomal protein S11
 gi|59798873|sp|Q7WR99|RS11_BORBR RecName: Full=30S ribosomal protein S11
 gi|123752387|sp|Q2L245|RS11_BORA1 RecName: Full=30S ribosomal protein S11
 gi|33564581|emb|CAE43897.1| 30S ribosomal protein S11 [Bordetella pertussis Tohama I]
 gi|33564852|emb|CAE39796.1| 30S ribosomal protein S11 [Bordetella parapertussis]
 gi|33575094|emb|CAE30557.1| 30S ribosomal protein S11 [Bordetella bronchiseptica RB50]
 gi|115421158|emb|CAJ47642.1| 30S ribosomal protein S11 [Bordetella avium 197N]
          Length = 133

 Score =  137 bits (345), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 89/124 (71%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           SR+R + +KN+  G AHV ++FNNT ITITD  GN ++W++    GF GSRK++PFAAQV
Sbjct: 10  SRVRKKVKKNVSDGIAHVHASFNNTIITITDRQGNALSWATSGGAGFKGSRKSTPFAAQV 69

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +     A  +G+ +LEV++ G G GR+S++RAL A+G  I SI D+T + HNGCRP K
Sbjct: 70  AAETAGRVAMEYGIKTLEVRIKGPGPGRESSVRALNALGIKISSIADITPVPHNGCRPPK 129

Query: 126 RRRI 129
           RRRI
Sbjct: 130 RRRI 133


>gi|241763533|ref|ZP_04761585.1| ribosomal protein S11 [Acidovorax delafieldii 2AN]
 gi|241367264|gb|EER61604.1| ribosomal protein S11 [Acidovorax delafieldii 2AN]
          Length = 134

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 95/134 (70%), Gaps = 5/134 (3%)

Query: 1   MPKSPS-----RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGS 55
           M KSP+     R+R + RKN+  G AHV ++FNNT ITITD  GN ++W+S    GF GS
Sbjct: 1   MAKSPANNAAQRVRKKVRKNVSDGIAHVHASFNNTIITITDRQGNALSWASSGGQGFKGS 60

Query: 56  RKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTM 115
           RK++PFAAQVA++     A + G+ +L+V++ G G GR+S++RAL A+G  I SI DVT 
Sbjct: 61  RKSTPFAAQVASEVAGRAAIDQGIKNLDVEIKGPGPGRESSVRALGALGIRITSISDVTP 120

Query: 116 IAHNGCRPRKRRRI 129
           + HNGCRP+KRRRI
Sbjct: 121 VPHNGCRPQKRRRI 134


>gi|109897337|ref|YP_660592.1| 30S ribosomal protein S11 [Pseudoalteromonas atlantica T6c]
 gi|123064914|sp|Q15X50|RS11_PSEA6 RecName: Full=30S ribosomal protein S11
 gi|109699618|gb|ABG39538.1| SSU ribosomal protein S11P [Pseudoalteromonas atlantica T6c]
 gi|332175076|gb|AEE24330.1| 30S ribosomal protein S11 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 130

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 92/130 (70%), Gaps = 1/130 (0%)

Query: 1   MPKSPSR-IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           M K+P++  R R ++ +  G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++
Sbjct: 1   MAKAPTKSTRKRAKRQVADGMAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKST 60

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           PFAAQVA +     AQ++G+ +LEV V G G GR+SA+RAL A G+ I +I DVT I HN
Sbjct: 61  PFAAQVAAERAGTAAQDYGLKNLEVFVKGPGPGRESAIRALNAAGYKITNITDVTPIPHN 120

Query: 120 GCRPRKRRRI 129
           GCRP K+RR+
Sbjct: 121 GCRPPKKRRV 130


>gi|251799615|ref|YP_003014346.1| ribosomal protein S11 [Paenibacillus sp. JDR-2]
 gi|247547241|gb|ACT04260.1| ribosomal protein S11 [Paenibacillus sp. JDR-2]
          Length = 131

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 94/128 (73%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK   R + R+RKNI SG AH+ STFNNT +TITDPHGN I+W+S   +GF GSRK++PF
Sbjct: 4   PKKVVRTKRRDRKNIESGVAHIRSTFNNTIVTITDPHGNAISWASSGNLGFKGSRKSTPF 63

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ+A +  +  A  HGM ++EV V G GAGR++A+R+L+A G  +  I DVT + HNGC
Sbjct: 64  AAQMAAEAAAKAAMEHGMKAVEVMVKGPGAGREAAIRSLQAAGLEVNLIKDVTPVPHNGC 123

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 124 RPPKRRRV 131


>gi|94312224|ref|YP_585434.1| 30S ribosomal protein S11 [Cupriavidus metallidurans CH34]
 gi|123383592|sp|Q1LI61|RS11_RALME RecName: Full=30S ribosomal protein S11
 gi|93356076|gb|ABF10165.1| 30S ribosomal subunit protein S11 [Cupriavidus metallidurans CH34]
          Length = 133

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 69/133 (51%), Positives = 92/133 (69%), Gaps = 4/133 (3%)

Query: 1   MPKSPS----RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSR 56
           M K P+    R R + +KN+  G AHV ++FNNT ITITD  GN ++W++    GF GSR
Sbjct: 1   MAKGPNNAAQRARKKVKKNVADGIAHVHASFNNTIITITDRQGNALSWATAGGQGFKGSR 60

Query: 57  KNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMI 116
           K++PFAAQVA ++    AQ+ G+ +LEV++ G G GR+SA+RAL A+G  I  I DVT +
Sbjct: 61  KSTPFAAQVAAENAGRVAQDQGIKNLEVRIKGPGPGRESAVRALNALGIKIAVIEDVTPV 120

Query: 117 AHNGCRPRKRRRI 129
            HNGCRP KRRRI
Sbjct: 121 PHNGCRPPKRRRI 133


>gi|121609262|ref|YP_997069.1| 30S ribosomal protein S11 [Verminephrobacter eiseniae EF01-2]
 gi|152060830|sp|A1WK94|RS11_VEREI RecName: Full=30S ribosomal protein S11
 gi|121553902|gb|ABM58051.1| SSU ribosomal protein S11P [Verminephrobacter eiseniae EF01-2]
          Length = 134

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 94/134 (70%), Gaps = 5/134 (3%)

Query: 1   MPKSP-----SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGS 55
           M KSP      R+R + RKN+  G AHV ++FNNT ITITD  GN ++W+S    GF GS
Sbjct: 1   MAKSPVNNAAQRVRKKVRKNVADGIAHVHASFNNTIITITDRQGNALSWASSGGQGFKGS 60

Query: 56  RKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTM 115
           RK++PFAAQVA++     A + G+ +L+V++ G G GR+S++RAL A+G  I SI DVT 
Sbjct: 61  RKSTPFAAQVASEVAGRAAIDQGIKNLDVEIRGPGPGRESSVRALGALGIRITSISDVTP 120

Query: 116 IAHNGCRPRKRRRI 129
           + HNGCRP+KRRRI
Sbjct: 121 VPHNGCRPQKRRRI 134


>gi|288554752|ref|YP_003426687.1| 30S ribosomal protein S11 [Bacillus pseudofirmus OF4]
 gi|288545912|gb|ADC49795.1| 30S ribosomal protein S11 [Bacillus pseudofirmus OF4]
          Length = 130

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 95/127 (74%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K+ +R + R+RKN+ +G AH+ STFNNT +TITD HGN I+W+S   +GF GSRK++PFA
Sbjct: 4   KTNTRPKRRQRKNVEAGVAHIRSTFNNTIVTITDTHGNAISWASAGALGFKGSRKSTPFA 63

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  +  A  HGM ++EV V G GAGR++A+R+L+A+G  +  I DVT + HNGCR
Sbjct: 64  AQMAAETAAKTAMEHGMKTIEVSVKGPGAGREAAIRSLQAVGLEVNMIKDVTPVPHNGCR 123

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 124 PPKRRRV 130


>gi|33357888|pdb|1P6G|K Chain K, Real Space Refined Coordinates Of The 30s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
           State Of E. Coli 70s Ribosome
 gi|33357965|pdb|1P87|K Chain K, Real Space Refined Coordinates Of The 30s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The
           Initiation-Like State Of E. Coli 70s Ribosome
 gi|83754049|pdb|2AVY|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|83754105|pdb|2AW7|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 30s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes And Is
           Described In Remark 400.
 gi|118138063|pdb|2I2P|K Chain K, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|118138134|pdb|2I2U|K Chain K, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|157836033|pdb|2QOU|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 30s Subunit Of The First 70s Ribosome,
           With Spectinomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|157836081|pdb|2QOW|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 30s Subunit Of The Second 70s
           Ribosome, With Spectinomycin Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|157836137|pdb|2QOY|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome, With Spectinomycin And Neomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 gi|157836185|pdb|2QP0|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome, With Spectinomycin And Neomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 gi|158429708|pdb|2QAL|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Neomycin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 gi|158429760|pdb|2QAN|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Neomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429818|pdb|2QB9|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Gentamicin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 gi|158429870|pdb|2QBB|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Gentamicin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429922|pdb|2QBD|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 30s Subunit Of The
           First 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429974|pdb|2QBF|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 30s Subunit Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158430028|pdb|2QBH|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 30s
           Subunit Of The First 70s Ribosome, With Gentamicin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158430081|pdb|2QBJ|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 30s
           Subunit Of The Second 70s Ribosome, With Gentamicin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158431381|pdb|2Z4K|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           30s Subunit Of The First 70s Ribosome, With Paromomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158431434|pdb|2Z4M|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           30s Subunit Of The Second 70s Ribosome, With Paromomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|168988798|pdb|2VHO|K Chain K, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 3 Of 4)
 gi|168988819|pdb|2VHP|K Chain K, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 4 Of 4)
 gi|197107288|pdb|3DF1|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Hygromycin B Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|197107340|pdb|3DF3|K Chain K, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Hygromycin B Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|329666002|pdb|3J00|K Chain K, Structure Of The Ribosome-Secye Complex In The Membrane
           Environment
          Length = 128

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 66/127 (51%), Positives = 88/127 (69%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K+P R R R RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++PFA
Sbjct: 2   KAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA 61

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNGCR
Sbjct: 62  AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCR 121

Query: 123 PRKRRRI 129
           P K+RR+
Sbjct: 122 PPKKRRV 128


>gi|120609324|ref|YP_969002.1| 30S ribosomal protein S11 [Acidovorax citrulli AAC00-1]
 gi|319764616|ref|YP_004128553.1| 30S ribosomal protein s11 [Alicycliphilus denitrificans BC]
 gi|326315413|ref|YP_004233085.1| 30S ribosomal protein S11 [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|330826873|ref|YP_004390176.1| 30S ribosomal protein S11 [Alicycliphilus denitrificans K601]
 gi|152060564|sp|A1TJU0|RS11_ACIAC RecName: Full=30S ribosomal protein S11
 gi|120587788|gb|ABM31228.1| SSU ribosomal protein S11P [Acidovorax citrulli AAC00-1]
 gi|317119177|gb|ADV01666.1| 30S ribosomal protein S11 [Alicycliphilus denitrificans BC]
 gi|323372249|gb|ADX44518.1| 30S ribosomal protein S11 [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|329312245|gb|AEB86660.1| 30S ribosomal protein S11 [Alicycliphilus denitrificans K601]
          Length = 134

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 94/134 (70%), Gaps = 5/134 (3%)

Query: 1   MPKSPS-----RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGS 55
           M KSP+     R+R + RKN+  G AHV ++FNNT ITITD  GN ++W+S    GF GS
Sbjct: 1   MAKSPANNAAQRVRKKVRKNVSDGIAHVHASFNNTIITITDRQGNALSWASSGGQGFKGS 60

Query: 56  RKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTM 115
           RK++PFAAQVA++     A   G+ +L+V++ G G GR+S++RAL A+G  I SI DVT 
Sbjct: 61  RKSTPFAAQVASEVAGRAAIEQGIKNLDVEIKGPGPGRESSVRALGALGIRITSISDVTP 120

Query: 116 IAHNGCRPRKRRRI 129
           + HNGCRP+KRRRI
Sbjct: 121 VPHNGCRPQKRRRI 134


>gi|54778764|gb|AAV39598.1| ribosomal protein S11 [synthetic construct]
          Length = 156

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 66/127 (51%), Positives = 88/127 (69%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K+P R R R RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++PFA
Sbjct: 27  KAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA 86

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNGCR
Sbjct: 87  AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCR 146

Query: 123 PRKRRRI 129
           P K+RR+
Sbjct: 147 PPKKRRV 153


>gi|242624286|ref|YP_003002204.1| 30S ribosomal protein S11 [Aureoumbra lagunensis]
 gi|239997394|gb|ACS36916.1| 30S ribosomal protein S11 [Aureoumbra lagunensis]
          Length = 130

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 64/119 (53%), Positives = 85/119 (71%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           +++KNI  G  H+ STFNNT ITITD  GNTI+WSS   VGF G+RK +PFAAQ A +  
Sbjct: 12  KQKKNIPFGVVHINSTFNNTIITITDASGNTISWSSAGSVGFKGARKGTPFAAQTAAEKA 71

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           S  A   G+  ++V + G G+GR++++RAL A+G  +VSI D+T I HNGCRP KRRR+
Sbjct: 72  SLTAMEQGLKRVDVVIKGQGSGRETSVRALEAVGLDVVSIKDITSIPHNGCRPPKRRRV 130


>gi|69247194|ref|ZP_00604256.1| Ribosomal protein S11 [Enterococcus faecium DO]
 gi|227550744|ref|ZP_03980793.1| ribosomal protein S11 [Enterococcus faecium TX1330]
 gi|257878749|ref|ZP_05658402.1| ribosomal protein S11 [Enterococcus faecium 1,230,933]
 gi|257881391|ref|ZP_05661044.1| ribosomal protein S11 [Enterococcus faecium 1,231,502]
 gi|257885658|ref|ZP_05665311.1| ribosomal protein S11 [Enterococcus faecium 1,231,501]
 gi|257887997|ref|ZP_05667650.1| ribosomal protein S11 [Enterococcus faecium 1,141,733]
 gi|257890608|ref|ZP_05670261.1| ribosomal protein S11 [Enterococcus faecium 1,231,410]
 gi|257893199|ref|ZP_05672852.1| ribosomal protein S11 [Enterococcus faecium 1,231,408]
 gi|257896384|ref|ZP_05676037.1| ribosomal protein S11 [Enterococcus faecium Com12]
 gi|257899359|ref|ZP_05679012.1| ribosomal protein S11 [Enterococcus faecium Com15]
 gi|258615186|ref|ZP_05712956.1| 30S ribosomal protein S11 [Enterococcus faecium DO]
 gi|260558312|ref|ZP_05830508.1| ribosomal protein S11 [Enterococcus faecium C68]
 gi|261207017|ref|ZP_05921706.1| ribosomal protein S11 [Enterococcus faecium TC 6]
 gi|289565348|ref|ZP_06445798.1| 30S ribosomal protein S11 [Enterococcus faecium D344SRF]
 gi|293379470|ref|ZP_06625614.1| 30S ribosomal protein S11 [Enterococcus faecium PC4.1]
 gi|293553903|ref|ZP_06674509.1| 30S ribosomal protein S11 [Enterococcus faecium E1039]
 gi|293562971|ref|ZP_06677438.1| ribosomal protein S11 [Enterococcus faecium E1162]
 gi|293567907|ref|ZP_06679248.1| ribosomal protein S11 [Enterococcus faecium E1071]
 gi|293570708|ref|ZP_06681758.1| ribosomal protein S11 [Enterococcus faecium E980]
 gi|294615369|ref|ZP_06695242.1| ribosomal protein S11 [Enterococcus faecium E1636]
 gi|294618295|ref|ZP_06697876.1| ribosomal protein S11 [Enterococcus faecium E1679]
 gi|294621103|ref|ZP_06700294.1| ribosomal protein S11 [Enterococcus faecium U0317]
 gi|314937633|ref|ZP_07844959.1| 30S ribosomal protein S11 [Enterococcus faecium TX0133a04]
 gi|314942868|ref|ZP_07849681.1| 30S ribosomal protein S11 [Enterococcus faecium TX0133C]
 gi|314947996|ref|ZP_07851400.1| 30S ribosomal protein S11 [Enterococcus faecium TX0082]
 gi|314950913|ref|ZP_07853982.1| 30S ribosomal protein S11 [Enterococcus faecium TX0133A]
 gi|314991439|ref|ZP_07856916.1| 30S ribosomal protein S11 [Enterococcus faecium TX0133B]
 gi|314995040|ref|ZP_07860160.1| 30S ribosomal protein S11 [Enterococcus faecium TX0133a01]
 gi|68194959|gb|EAN09427.1| Ribosomal protein S11 [Enterococcus faecium DO]
 gi|227180205|gb|EEI61177.1| ribosomal protein S11 [Enterococcus faecium TX1330]
 gi|257812977|gb|EEV41735.1| ribosomal protein S11 [Enterococcus faecium 1,230,933]
 gi|257817049|gb|EEV44377.1| ribosomal protein S11 [Enterococcus faecium 1,231,502]
 gi|257821514|gb|EEV48644.1| ribosomal protein S11 [Enterococcus faecium 1,231,501]
 gi|257824051|gb|EEV50983.1| ribosomal protein S11 [Enterococcus faecium 1,141,733]
 gi|257826968|gb|EEV53594.1| ribosomal protein S11 [Enterococcus faecium 1,231,410]
 gi|257829578|gb|EEV56185.1| ribosomal protein S11 [Enterococcus faecium 1,231,408]
 gi|257832949|gb|EEV59370.1| ribosomal protein S11 [Enterococcus faecium Com12]
 gi|257837271|gb|EEV62345.1| ribosomal protein S11 [Enterococcus faecium Com15]
 gi|260075486|gb|EEW63792.1| ribosomal protein S11 [Enterococcus faecium C68]
 gi|260078645|gb|EEW66347.1| ribosomal protein S11 [Enterococcus faecium TC 6]
 gi|289162838|gb|EFD10688.1| 30S ribosomal protein S11 [Enterococcus faecium D344SRF]
 gi|291589492|gb|EFF21299.1| ribosomal protein S11 [Enterococcus faecium E1071]
 gi|291591743|gb|EFF23379.1| ribosomal protein S11 [Enterococcus faecium E1636]
 gi|291595389|gb|EFF26701.1| ribosomal protein S11 [Enterococcus faecium E1679]
 gi|291599339|gb|EFF30365.1| ribosomal protein S11 [Enterococcus faecium U0317]
 gi|291601955|gb|EFF32201.1| 30S ribosomal protein S11 [Enterococcus faecium E1039]
 gi|291605097|gb|EFF34564.1| ribosomal protein S11 [Enterococcus faecium E1162]
 gi|291609180|gb|EFF38452.1| ribosomal protein S11 [Enterococcus faecium E980]
 gi|292641993|gb|EFF60159.1| 30S ribosomal protein S11 [Enterococcus faecium PC4.1]
 gi|313590766|gb|EFR69611.1| 30S ribosomal protein S11 [Enterococcus faecium TX0133a01]
 gi|313593919|gb|EFR72764.1| 30S ribosomal protein S11 [Enterococcus faecium TX0133B]
 gi|313596922|gb|EFR75767.1| 30S ribosomal protein S11 [Enterococcus faecium TX0133A]
 gi|313598340|gb|EFR77185.1| 30S ribosomal protein S11 [Enterococcus faecium TX0133C]
 gi|313643010|gb|EFS07590.1| 30S ribosomal protein S11 [Enterococcus faecium TX0133a04]
 gi|313645594|gb|EFS10174.1| 30S ribosomal protein S11 [Enterococcus faecium TX0082]
          Length = 129

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 88/121 (72%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT I ITD HGN +AWSS   +GF GS+K++PFAAQ+A +
Sbjct: 9   KRRVKKNIEAGIAHIHSTFNNTIIMITDTHGNALAWSSAGSLGFKGSKKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ ++EV V G G+GR++A+R+L+A G  + +I DVT + HNG RP KRRR
Sbjct: 69  TATKAAMEHGLKTVEVTVKGPGSGREAAIRSLQATGLEVTAIRDVTPVPHNGARPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|163859247|ref|YP_001633545.1| 30S ribosomal protein S11 [Bordetella petrii DSM 12804]
 gi|293602600|ref|ZP_06685043.1| 30S ribosomal protein S11 [Achromobacter piechaudii ATCC 43553]
 gi|311109578|ref|YP_003982431.1| 30S ribosomal protein S11 [Achromobacter xylosoxidans A8]
 gi|226708335|sp|A9IHR9|RS11_BORPD RecName: Full=30S ribosomal protein S11
 gi|163262975|emb|CAP45278.1| 30S ribosomal protein S11 [Bordetella petrii]
 gi|292818972|gb|EFF78010.1| 30S ribosomal protein S11 [Achromobacter piechaudii ATCC 43553]
 gi|310764267|gb|ADP19716.1| 30S ribosomal protein S11 [Achromobacter xylosoxidans A8]
 gi|317401572|gb|EFV82201.1| 30S ribosomal protein S11 [Achromobacter xylosoxidans C54]
          Length = 133

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 89/124 (71%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           SR+R + +KN+  G AHV ++FNNT ITITD  GN ++W++    GF GSRK++PFAAQV
Sbjct: 10  SRVRKKVKKNVSDGIAHVHASFNNTIITITDRQGNALSWATSGGAGFKGSRKSTPFAAQV 69

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +     A  +G+ +LEV++ G G GR+S++RAL A+G  I SI D+T + HNGCRP K
Sbjct: 70  AAETAGRVALEYGIKTLEVRIKGPGPGRESSVRALNALGIKISSIADITPVPHNGCRPPK 129

Query: 126 RRRI 129
           RRRI
Sbjct: 130 RRRI 133


>gi|88861471|ref|ZP_01136097.1| 30S ribosomal subunit protein S11 [Pseudoalteromonas tunicata D2]
 gi|88816519|gb|EAR26348.1| 30S ribosomal subunit protein S11 [Pseudoalteromonas tunicata D2]
          Length = 128

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 91/129 (70%), Gaps = 1/129 (0%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R + +K +  G AHV ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKAPIR-RKKVKKQVADGMAHVHASFNNTIVTITDRQGNALSWATAGGSGFRGSRKSTP 59

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     AQ +G+ +LEV + G G GR+SA+RAL A+G+ I +I DVT I HNG
Sbjct: 60  FAAQVAAERAGTAAQEYGLKNLEVFIKGPGPGRESAVRALNAVGYRITNITDVTPIPHNG 119

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 120 CRPPKKRRV 128


>gi|145225548|ref|YP_001136226.1| 30S ribosomal protein S11 [Mycobacterium gilvum PYR-GCK]
 gi|315445900|ref|YP_004078779.1| 30S ribosomal protein S11P [Mycobacterium sp. Spyr1]
 gi|189040422|sp|A4TEI1|RS11_MYCGI RecName: Full=30S ribosomal protein S11
 gi|145218034|gb|ABP47438.1| SSU ribosomal protein S11P [Mycobacterium gilvum PYR-GCK]
 gi|315264203|gb|ADU00945.1| SSU ribosomal protein S11P [Mycobacterium sp. Spyr1]
          Length = 136

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 69/128 (53%), Positives = 94/128 (73%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK   + R RE+KN+  G AH+ STFNNT ++ITDP GN IAW+S   VGF GSRK++PF
Sbjct: 9   PKKGQKTRRREKKNVPHGAAHIKSTFNNTIVSITDPQGNVIAWASSGHVGFKGSRKSTPF 68

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ+A ++ + KAQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGC
Sbjct: 69  AAQLAAENAARKAQEHGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGAIADVTPQPHNGC 128

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 129 RPPKRRRV 136


>gi|310644173|ref|YP_003948932.1| 30S ribosomal protein s11 [Paenibacillus polymyxa SC2]
 gi|309249124|gb|ADO58691.1| 30S ribosomal protein S11 [Paenibacillus polymyxa SC2]
          Length = 131

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 94/128 (73%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK   R + R+RKNI SG AH+ STFNNT +TITDPHGN I+W+S   +GF GSRK++PF
Sbjct: 4   PKKVVRTKRRDRKNIESGVAHIRSTFNNTIVTITDPHGNAISWASSGGMGFRGSRKSTPF 63

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ+A +  +  A  HGM ++EV V G GAGR++A+R+L+A G  +  I DVT + HNGC
Sbjct: 64  AAQMAAETAAKAAMEHGMKTVEVMVKGPGAGREAAIRSLQAAGLEVNLIKDVTPVPHNGC 123

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 124 RPPKRRRV 131


>gi|88812734|ref|ZP_01127980.1| 30S ribosomal subunit protein S11 [Nitrococcus mobilis Nb-231]
 gi|88789972|gb|EAR21093.1| 30S ribosomal subunit protein S11 [Nitrococcus mobilis Nb-231]
          Length = 129

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 92/129 (71%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+ SR R R ++ +V G AH+ ++FNNT IT+TD  GN +AW+S    GF  SRK++P
Sbjct: 1   MAKASSRTRKRVKRTVVDGIAHINASFNNTIITLTDRQGNVLAWASAGGSGFRSSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA++     A+++G+ +LEV+V G G GR+SA+RAL   G+ I +I DVT I HNG
Sbjct: 61  FAAQVASERAGEAAKDYGLKNLEVRVKGPGPGRESAVRALNNAGYRITNISDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|120402445|ref|YP_952274.1| 30S ribosomal protein S11 [Mycobacterium vanbaalenii PYR-1]
 gi|152060799|sp|A1T518|RS11_MYCVP RecName: Full=30S ribosomal protein S11
 gi|119955263|gb|ABM12268.1| SSU ribosomal protein S11P [Mycobacterium vanbaalenii PYR-1]
          Length = 137

 Score =  136 bits (343), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 69/128 (53%), Positives = 94/128 (73%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK   + R RE+KN+  G AH+ STFNNT ++ITDP GN IAW+S   VGF GSRK++PF
Sbjct: 10  PKKGQKTRRREKKNVPHGAAHIKSTFNNTIVSITDPQGNVIAWASSGHVGFKGSRKSTPF 69

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ+A ++ + KAQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGC
Sbjct: 70  AAQLAAENAARKAQEHGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGAISDVTPQPHNGC 129

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 130 RPPKRRRV 137


>gi|121603258|ref|YP_980587.1| 30S ribosomal protein S11 [Polaromonas naphthalenivorans CJ2]
 gi|152060804|sp|A1VJ38|RS11_POLNA RecName: Full=30S ribosomal protein S11
 gi|120592227|gb|ABM35666.1| SSU ribosomal protein S11P [Polaromonas naphthalenivorans CJ2]
          Length = 134

 Score =  136 bits (343), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 94/134 (70%), Gaps = 5/134 (3%)

Query: 1   MPKSPS-----RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGS 55
           M KSP+     R+R + RKN+  G AHV ++FNNT ITITD  GN ++W+S    GF GS
Sbjct: 1   MAKSPNNSAAQRVRKKVRKNVADGIAHVHASFNNTIITITDRQGNALSWASSGGQGFKGS 60

Query: 56  RKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTM 115
           RK++PFAAQVA++     A   G+ +L+V++ G G GR+S++RAL A+G  I SI DVT 
Sbjct: 61  RKSTPFAAQVASEVAGRAAIEQGIKNLDVEIKGPGPGRESSVRALGALGIRINSIADVTP 120

Query: 116 IAHNGCRPRKRRRI 129
           + HNGCRP+KRRRI
Sbjct: 121 VPHNGCRPQKRRRI 134


>gi|239818005|ref|YP_002946915.1| 30S ribosomal protein S11 [Variovorax paradoxus S110]
 gi|319796382|ref|YP_004158022.1| 30S ribosomal protein s11 [Variovorax paradoxus EPS]
 gi|259494640|sp|C5CQ77|RS11_VARPS RecName: Full=30S ribosomal protein S11
 gi|239804582|gb|ACS21649.1| ribosomal protein S11 [Variovorax paradoxus S110]
 gi|315598845|gb|ADU39911.1| 30S ribosomal protein S11 [Variovorax paradoxus EPS]
          Length = 134

 Score =  136 bits (343), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 94/134 (70%), Gaps = 5/134 (3%)

Query: 1   MPKSPS-----RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGS 55
           M K+P+     R+R + RKN+  G AHV ++FNNT ITITD  GN ++W+S    GF GS
Sbjct: 1   MAKAPANNAAQRVRKKVRKNVADGIAHVHASFNNTIITITDRQGNALSWASSGGQGFKGS 60

Query: 56  RKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTM 115
           RK++PFAAQVA++     A   G+ +L+V++ G G GR+S++RAL A+G  I SI DVT 
Sbjct: 61  RKSTPFAAQVASEVAGRAAVEQGIKNLDVEIKGPGPGRESSVRALAALGIRINSIADVTP 120

Query: 116 IAHNGCRPRKRRRI 129
           + HNGCRP+KRRRI
Sbjct: 121 VPHNGCRPQKRRRI 134


>gi|116749015|ref|YP_845702.1| 30S ribosomal protein S11 [Syntrophobacter fumaroxidans MPOB]
 gi|152060828|sp|A0LIL5|RS11_SYNFM RecName: Full=30S ribosomal protein S11
 gi|116698079|gb|ABK17267.1| SSU ribosomal protein S11P [Syntrophobacter fumaroxidans MPOB]
          Length = 130

 Score =  136 bits (343), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 95/127 (74%), Gaps = 1/127 (0%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K+ SR + +ERKNI++G AH+ STFNNT +TITD  GN I+WSS    GF GSRK++PFA
Sbjct: 5   KAASR-KKKERKNILNGIAHIRSTFNNTIVTITDASGNAISWSSAGSQGFKGSRKSTPFA 63

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQVA +  + KA  HG+ ++EV V G G+GR++ALRAL+A GF I  I DVT I HNGCR
Sbjct: 64  AQVAAEIAAKKAMEHGVQNIEVYVKGPGSGREAALRALQAAGFNITVIKDVTPIPHNGCR 123

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 124 PPKRRRV 130


>gi|167564392|ref|ZP_02357308.1| ribosomal protein S11 [Burkholderia oklahomensis EO147]
 gi|167571539|ref|ZP_02364413.1| ribosomal protein S11 [Burkholderia oklahomensis C6786]
          Length = 133

 Score =  136 bits (343), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 86/123 (69%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R+R + +KN+  G  HV ++FNNT ITITD  GN +AW++    GF GSRK++PFAAQVA
Sbjct: 11  RVRKKVKKNVAEGVVHVHASFNNTIITITDRQGNALAWATSGGQGFKGSRKSTPFAAQVA 70

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +     A  +G+ +LEV++ G G GR+SA+RAL  +G  I +I DVT I HNGCRP KR
Sbjct: 71  AESAGRVAMEYGVKNLEVRIKGPGPGRESAVRALHGLGIKITAISDVTPIPHNGCRPPKR 130

Query: 127 RRI 129
           RRI
Sbjct: 131 RRI 133


>gi|53720797|ref|YP_109783.1| 30S ribosomal protein S11 [Burkholderia pseudomallei K96243]
 gi|53723830|ref|YP_104142.1| 30S ribosomal protein S11 [Burkholderia mallei ATCC 23344]
 gi|76809500|ref|YP_335116.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1710b]
 gi|78064948|ref|YP_367717.1| 30S ribosomal protein S11 [Burkholderia sp. 383]
 gi|83719823|ref|YP_443548.1| 30S ribosomal protein S11 [Burkholderia thailandensis E264]
 gi|107024279|ref|YP_622606.1| 30S ribosomal protein S11 [Burkholderia cenocepacia AU 1054]
 gi|115350346|ref|YP_772185.1| 30S ribosomal protein S11 [Burkholderia ambifaria AMMD]
 gi|116688396|ref|YP_834019.1| 30S ribosomal protein S11 [Burkholderia cenocepacia HI2424]
 gi|121600264|ref|YP_994432.1| 30S ribosomal protein S11 [Burkholderia mallei SAVP1]
 gi|124383942|ref|YP_001027919.1| 30S ribosomal protein S11 [Burkholderia mallei NCTC 10229]
 gi|126438369|ref|YP_001060726.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 668]
 gi|126449962|ref|YP_001083014.1| 30S ribosomal protein S11 [Burkholderia mallei NCTC 10247]
 gi|126455195|ref|YP_001068010.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1106a]
 gi|134283319|ref|ZP_01770020.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 305]
 gi|134294467|ref|YP_001118202.1| 30S ribosomal protein S11 [Burkholderia vietnamiensis G4]
 gi|161523453|ref|YP_001578465.1| 30S ribosomal protein S11 [Burkholderia multivorans ATCC 17616]
 gi|167001675|ref|ZP_02267467.1| 30S ribosomal protein S11 [Burkholderia mallei PRL-20]
 gi|167582599|ref|ZP_02375473.1| ribosomal protein S11 [Burkholderia thailandensis TXDOH]
 gi|167620713|ref|ZP_02389344.1| ribosomal protein S11 [Burkholderia thailandensis Bt4]
 gi|167721553|ref|ZP_02404789.1| ribosomal protein S11 [Burkholderia pseudomallei DM98]
 gi|167740527|ref|ZP_02413301.1| ribosomal protein S11 [Burkholderia pseudomallei 14]
 gi|167817732|ref|ZP_02449412.1| ribosomal protein S11 [Burkholderia pseudomallei 91]
 gi|167826129|ref|ZP_02457600.1| ribosomal protein S11 [Burkholderia pseudomallei 9]
 gi|167838188|ref|ZP_02465047.1| ribosomal protein S11 [Burkholderia thailandensis MSMB43]
 gi|167847641|ref|ZP_02473149.1| ribosomal protein S11 [Burkholderia pseudomallei B7210]
 gi|167896213|ref|ZP_02483615.1| ribosomal protein S11 [Burkholderia pseudomallei 7894]
 gi|167904595|ref|ZP_02491800.1| ribosomal protein S11 [Burkholderia pseudomallei NCTC 13177]
 gi|167912860|ref|ZP_02499951.1| ribosomal protein S11 [Burkholderia pseudomallei 112]
 gi|167920819|ref|ZP_02507910.1| ribosomal protein S11 [Burkholderia pseudomallei BCC215]
 gi|170700718|ref|ZP_02891713.1| ribosomal protein S11 [Burkholderia ambifaria IOP40-10]
 gi|170731706|ref|YP_001763653.1| 30S ribosomal protein S11 [Burkholderia cenocepacia MC0-3]
 gi|171318372|ref|ZP_02907530.1| ribosomal protein S11 [Burkholderia ambifaria MEX-5]
 gi|172059365|ref|YP_001807017.1| 30S ribosomal protein S11 [Burkholderia ambifaria MC40-6]
 gi|189351774|ref|YP_001947402.1| 30S ribosomal protein S11 [Burkholderia multivorans ATCC 17616]
 gi|206558665|ref|YP_002229425.1| 30S ribosomal protein S11 [Burkholderia cenocepacia J2315]
 gi|217424730|ref|ZP_03456227.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 576]
 gi|221201589|ref|ZP_03574627.1| 30S ribosomal protein S11 [Burkholderia multivorans CGD2M]
 gi|221207336|ref|ZP_03580346.1| 30S ribosomal protein S11 [Burkholderia multivorans CGD2]
 gi|221213474|ref|ZP_03586449.1| 30S ribosomal protein S11 [Burkholderia multivorans CGD1]
 gi|226198281|ref|ZP_03793852.1| 30S ribosomal protein S11 [Burkholderia pseudomallei Pakistan 9]
 gi|237814121|ref|YP_002898572.1| 30S ribosomal protein S11 [Burkholderia pseudomallei MSHR346]
 gi|238562960|ref|ZP_00439642.2| 30S ribosomal protein S11 [Burkholderia mallei GB8 horse 4]
 gi|242317635|ref|ZP_04816651.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1106b]
 gi|254175001|ref|ZP_04881662.1| 30S ribosomal protein S11 [Burkholderia mallei ATCC 10399]
 gi|254180363|ref|ZP_04886961.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1655]
 gi|254190326|ref|ZP_04896834.1| 30S ribosomal protein S11 [Burkholderia pseudomallei Pasteur 52237]
 gi|254198467|ref|ZP_04904888.1| 30S ribosomal protein S11 [Burkholderia pseudomallei S13]
 gi|254201215|ref|ZP_04907579.1| 30S ribosomal protein S11 [Burkholderia mallei FMH]
 gi|254206556|ref|ZP_04912907.1| 30S ribosomal protein S11 [Burkholderia mallei JHU]
 gi|254246579|ref|ZP_04939900.1| Ribosomal protein S11 [Burkholderia cenocepacia PC184]
 gi|254253496|ref|ZP_04946814.1| Ribosomal protein S11 [Burkholderia dolosa AUO158]
 gi|254260898|ref|ZP_04951952.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1710a]
 gi|254300600|ref|ZP_04968045.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 406e]
 gi|254357094|ref|ZP_04973368.1| 30S ribosomal protein S11 [Burkholderia mallei 2002721280]
 gi|257137666|ref|ZP_05585928.1| 30S ribosomal protein S11 [Burkholderia thailandensis E264]
 gi|59798631|sp|Q62GM9|RS11_BURMA RecName: Full=30S ribosomal protein S11
 gi|59798642|sp|Q63Q35|RS11_BURPS RecName: Full=30S ribosomal protein S11
 gi|91207733|sp|Q3JMT7|RS11_BURP1 RecName: Full=30S ribosomal protein S11
 gi|91207734|sp|Q39KE3|RS11_BURS3 RecName: Full=30S ribosomal protein S11
 gi|122324242|sp|Q0BJ22|RS11_BURCM RecName: Full=30S ribosomal protein S11
 gi|123244314|sp|Q1BRX2|RS11_BURCA RecName: Full=30S ribosomal protein S11
 gi|123726557|sp|Q2SU51|RS11_BURTA RecName: Full=30S ribosomal protein S11
 gi|152060579|sp|A0K3P9|RS11_BURCH RecName: Full=30S ribosomal protein S11
 gi|152060580|sp|A3P089|RS11_BURP0 RecName: Full=30S ribosomal protein S11
 gi|166231803|sp|A3MRX8|RS11_BURM7 RecName: Full=30S ribosomal protein S11
 gi|166231804|sp|A2S7K0|RS11_BURM9 RecName: Full=30S ribosomal protein S11
 gi|166231805|sp|A1V879|RS11_BURMS RecName: Full=30S ribosomal protein S11
 gi|166231806|sp|A3NEF5|RS11_BURP6 RecName: Full=30S ribosomal protein S11
 gi|166231807|sp|A4JAR4|RS11_BURVG RecName: Full=30S ribosomal protein S11
 gi|226708337|sp|B1YRQ3|RS11_BURA4 RecName: Full=30S ribosomal protein S11
 gi|226708338|sp|B1JU46|RS11_BURCC RecName: Full=30S ribosomal protein S11
 gi|226708339|sp|B4E5E4|RS11_BURCJ RecName: Full=30S ribosomal protein S11
 gi|226708340|sp|A9ADL7|RS11_BURM1 RecName: Full=30S ribosomal protein S11
 gi|52211211|emb|CAH37200.1| 30S ribosomal protein S11 [Burkholderia pseudomallei K96243]
 gi|52427253|gb|AAU47846.1| ribosomal protein S11 [Burkholderia mallei ATCC 23344]
 gi|76578953|gb|ABA48428.1| ribosomal protein S11 [Burkholderia pseudomallei 1710b]
 gi|77965693|gb|ABB07073.1| SSU ribosomal protein S11P [Burkholderia sp. 383]
 gi|83653648|gb|ABC37711.1| ribosomal protein S11 [Burkholderia thailandensis E264]
 gi|105894468|gb|ABF77633.1| SSU ribosomal protein S11P [Burkholderia cenocepacia AU 1054]
 gi|115280334|gb|ABI85851.1| SSU ribosomal protein S11P [Burkholderia ambifaria AMMD]
 gi|116646485|gb|ABK07126.1| SSU ribosomal protein S11P [Burkholderia cenocepacia HI2424]
 gi|121229074|gb|ABM51592.1| 30S ribosomal protein S11 [Burkholderia mallei SAVP1]
 gi|124291962|gb|ABN01231.1| 30S ribosomal protein S11 [Burkholderia mallei NCTC 10229]
 gi|124871355|gb|EAY63071.1| Ribosomal protein S11 [Burkholderia cenocepacia PC184]
 gi|124896105|gb|EAY69985.1| Ribosomal protein S11 [Burkholderia dolosa AUO158]
 gi|126217862|gb|ABN81368.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 668]
 gi|126228837|gb|ABN92377.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1106a]
 gi|126242832|gb|ABO05925.1| 30S ribosomal protein S11 [Burkholderia mallei NCTC 10247]
 gi|134137624|gb|ABO53367.1| SSU ribosomal protein S11P [Burkholderia vietnamiensis G4]
 gi|134245514|gb|EBA45607.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 305]
 gi|147747109|gb|EDK54185.1| 30S ribosomal protein S11 [Burkholderia mallei FMH]
 gi|147752098|gb|EDK59164.1| 30S ribosomal protein S11 [Burkholderia mallei JHU]
 gi|148026158|gb|EDK84243.1| 30S ribosomal protein S11 [Burkholderia mallei 2002721280]
 gi|157810512|gb|EDO87682.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 406e]
 gi|157938002|gb|EDO93672.1| 30S ribosomal protein S11 [Burkholderia pseudomallei Pasteur 52237]
 gi|160340882|gb|ABX13968.1| ribosomal protein S11 [Burkholderia multivorans ATCC 17616]
 gi|160696046|gb|EDP86016.1| 30S ribosomal protein S11 [Burkholderia mallei ATCC 10399]
 gi|169655207|gb|EDS87900.1| 30S ribosomal protein S11 [Burkholderia pseudomallei S13]
 gi|169814948|gb|ACA89531.1| ribosomal protein S11 [Burkholderia cenocepacia MC0-3]
 gi|170134388|gb|EDT02721.1| ribosomal protein S11 [Burkholderia ambifaria IOP40-10]
 gi|171096450|gb|EDT41349.1| ribosomal protein S11 [Burkholderia ambifaria MEX-5]
 gi|171991882|gb|ACB62801.1| ribosomal protein S11 [Burkholderia ambifaria MC40-6]
 gi|184210902|gb|EDU07945.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1655]
 gi|189335796|dbj|BAG44866.1| small subunit ribosomal protein S11 [Burkholderia multivorans ATCC
           17616]
 gi|198034702|emb|CAR50569.1| 30S ribosomal protein S11 [Burkholderia cenocepacia J2315]
 gi|217392186|gb|EEC32211.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 576]
 gi|221166926|gb|EED99397.1| 30S ribosomal protein S11 [Burkholderia multivorans CGD1]
 gi|221172924|gb|EEE05361.1| 30S ribosomal protein S11 [Burkholderia multivorans CGD2]
 gi|221178405|gb|EEE10814.1| 30S ribosomal protein S11 [Burkholderia multivorans CGD2M]
 gi|225929801|gb|EEH25817.1| 30S ribosomal protein S11 [Burkholderia pseudomallei Pakistan 9]
 gi|237506148|gb|ACQ98466.1| 30S ribosomal protein S11 [Burkholderia pseudomallei MSHR346]
 gi|238521644|gb|EEP85094.1| 30S ribosomal protein S11 [Burkholderia mallei GB8 horse 4]
 gi|242140874|gb|EES27276.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1106b]
 gi|243062572|gb|EES44758.1| 30S ribosomal protein S11 [Burkholderia mallei PRL-20]
 gi|254219587|gb|EET08971.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1710a]
 gi|325529702|gb|EGD06565.1| 30S ribosomal protein S11 [Burkholderia sp. TJI49]
          Length = 133

 Score =  136 bits (343), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 86/124 (69%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
            R+R + +KN+  G  HV ++FNNT ITITD  GN +AW++    GF GSRK++PFAAQV
Sbjct: 10  QRVRKKVKKNVAEGVVHVHASFNNTIITITDRQGNALAWATSGGQGFKGSRKSTPFAAQV 69

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +     A  +G+ +LEV++ G G GR+SA+RAL  +G  I +I DVT I HNGCRP K
Sbjct: 70  AAESAGRVAMEYGVKNLEVRIKGPGPGRESAVRALHGLGIKITAISDVTPIPHNGCRPPK 129

Query: 126 RRRI 129
           RRRI
Sbjct: 130 RRRI 133


>gi|88799196|ref|ZP_01114776.1| Ribosomal protein S11 [Reinekea sp. MED297]
 gi|88778179|gb|EAR09374.1| Ribosomal protein S11 [Reinekea sp. MED297]
          Length = 129

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 63/129 (48%), Positives = 92/129 (71%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  ++ R + +K +  G AH+ ++FNNT +TITD  GNT++W++    GF GSRK++P
Sbjct: 1   MAKPGTKSRKKVKKQVADGIAHIHASFNNTIVTITDRQGNTLSWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +     AQ +G+ +L+V+V G G GR+SA+RAL A+G+ I +I DVT I HNG
Sbjct: 61  FAAQIAAERAGTAAQEYGLKNLDVEVKGPGPGRESAVRALNAVGYRISNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|319654895|ref|ZP_08008970.1| ribosomal protein S11 [Bacillus sp. 2_A_57_CT2]
 gi|317393458|gb|EFV74221.1| ribosomal protein S11 [Bacillus sp. 2_A_57_CT2]
          Length = 129

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI  G AH+ STFNNT +TITD HGN ++WSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVKKNIEQGIAHIRSTFNNTIVTITDVHGNAVSWSSAGALGFKGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  +Q HGM SLEV V G GAGR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TAAKTSQEHGMKSLEVTVKGPGAGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|238025956|ref|YP_002910187.1| 30S ribosomal protein S11 [Burkholderia glumae BGR1]
 gi|237875150|gb|ACR27483.1| 30S ribosomal protein S11 [Burkholderia glumae BGR1]
          Length = 133

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 86/124 (69%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
            R+R + +KN+  G  HV ++FNNT ITITD  GN +AW++    GF GSRK++PFAAQV
Sbjct: 10  QRVRKKVKKNVAEGVVHVHASFNNTIITITDRQGNALAWATSGGQGFKGSRKSTPFAAQV 69

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +     A  +G+ +LEV++ G G GR+SA+RAL  +G  I +I DVT I HNGCRP K
Sbjct: 70  AAESAGRVAMEYGVKNLEVRIKGPGPGRESAVRALHGLGIKITAISDVTPIPHNGCRPPK 129

Query: 126 RRRI 129
           RRRI
Sbjct: 130 RRRI 133


>gi|313884547|ref|ZP_07818308.1| 30S ribosomal protein S11 [Eremococcus coleocola ACS-139-V-Col8]
 gi|312620331|gb|EFR31759.1| 30S ribosomal protein S11 [Eremococcus coleocola ACS-139-V-Col8]
          Length = 130

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 87/117 (74%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KN+  G AH+ STFNNT + ITD +GN I+WSS   +GF GSRK++P+AAQ+A++  + 
Sbjct: 14  KKNVEKGIAHIRSTFNNTIVMITDENGNAISWSSAGSLGFRGSRKSTPYAAQMASEVAAK 73

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            A  HGM S+EV V G G+GR+SA+R+L+A G  + +I DVT I HNGCRP KRRR+
Sbjct: 74  GAMEHGMKSVEVAVKGPGSGRESAIRSLQATGLDVTAIRDVTPIPHNGCRPPKRRRV 130


>gi|312795801|ref|YP_004028723.1| SSU ribosomal protein S11P [Burkholderia rhizoxinica HKI 454]
 gi|312167576|emb|CBW74579.1| SSU ribosomal protein S11P [Burkholderia rhizoxinica HKI 454]
          Length = 134

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 86/123 (69%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R+R + +KN+  G  HV ++FNNT ITITD  GN +AW++    GF GSRK++PFAAQVA
Sbjct: 12  RVRKKVKKNVAEGVVHVHASFNNTIITITDRQGNALAWATSGGQGFKGSRKSTPFAAQVA 71

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +     A  +G+ +LEV++ G G GR+SA+RAL  +G  I SI DVT + HNGCRP KR
Sbjct: 72  AESAGRVAVEYGVKNLEVRIKGPGPGRESAVRALHGLGIKITSISDVTPVPHNGCRPPKR 131

Query: 127 RRI 129
           RRI
Sbjct: 132 RRI 134


>gi|114319642|ref|YP_741325.1| 30S ribosomal protein S11 [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312436|sp|Q0ABF2|RS11_ALHEH RecName: Full=30S ribosomal protein S11
 gi|114226036|gb|ABI55835.1| SSU ribosomal protein S11P [Alkalilimnicola ehrlichii MLHE-1]
          Length = 130

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 94/130 (72%), Gaps = 1/130 (0%)

Query: 1   MPKSPSRIR-NRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           M K+ +R R  R ++ +V G AH+ +TFNNT ITITD  GN +AW+S    GF GSRK++
Sbjct: 1   MAKAATRSRTKRAKRTVVDGIAHINATFNNTIITITDRQGNGLAWASAGGSGFRGSRKST 60

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           PFAAQVA++     A ++G+ +LEV+V G G GR+SA+RAL A+G+ I +I DV+ I HN
Sbjct: 61  PFAAQVASERAGRAALDYGLKNLEVRVKGPGPGRESAVRALNAVGYRITNISDVSPIPHN 120

Query: 120 GCRPRKRRRI 129
           GCRP K+RR+
Sbjct: 121 GCRPPKKRRV 130


>gi|289209306|ref|YP_003461372.1| 30S ribosomal protein S11 [Thioalkalivibrio sp. K90mix]
 gi|288944937|gb|ADC72636.1| 30S ribosomal protein S11 [Thioalkalivibrio sp. K90mix]
          Length = 129

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 91/129 (70%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M ++ +R + + RKNI  G AHV +TFNNT ITITD  GNTI+W++    GF GSRK++P
Sbjct: 1   MAQAQTRTKKKVRKNIAEGVAHVYATFNNTIITITDRQGNTISWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +   + A  HG+ +L+V V G G GR+SA+RAL   GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERAGSAAAEHGVKNLDVMVRGPGPGRESAVRALNNAGFKITNISDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|91785441|ref|YP_560647.1| 30S ribosomal protein S11 [Burkholderia xenovorans LB400]
 gi|170695705|ref|ZP_02886847.1| ribosomal protein S11 [Burkholderia graminis C4D1M]
 gi|186477563|ref|YP_001859033.1| 30S ribosomal protein S11 [Burkholderia phymatum STM815]
 gi|187925592|ref|YP_001897234.1| 30S ribosomal protein S11 [Burkholderia phytofirmans PsJN]
 gi|209521362|ref|ZP_03270075.1| ribosomal protein S11 [Burkholderia sp. H160]
 gi|295677908|ref|YP_003606432.1| 30S ribosomal protein S11 [Burkholderia sp. CCGE1002]
 gi|296163297|ref|ZP_06846058.1| 30S ribosomal protein S11 [Burkholderia sp. Ch1-1]
 gi|307731231|ref|YP_003908455.1| 30S ribosomal protein S11 [Burkholderia sp. CCGE1003]
 gi|323527578|ref|YP_004229731.1| 30S ribosomal protein S11 [Burkholderia sp. CCGE1001]
 gi|123167990|sp|Q13TJ4|RS11_BURXL RecName: Full=30S ribosomal protein S11
 gi|91689395|gb|ABE32595.1| SSU ribosomal protein S11P [Burkholderia xenovorans LB400]
 gi|170139310|gb|EDT07496.1| ribosomal protein S11 [Burkholderia graminis C4D1M]
 gi|184194022|gb|ACC71987.1| ribosomal protein S11 [Burkholderia phymatum STM815]
 gi|187716786|gb|ACD18010.1| ribosomal protein S11 [Burkholderia phytofirmans PsJN]
 gi|209498182|gb|EDZ98324.1| ribosomal protein S11 [Burkholderia sp. H160]
 gi|295437751|gb|ADG16921.1| 30S ribosomal protein S11 [Burkholderia sp. CCGE1002]
 gi|295886436|gb|EFG66293.1| 30S ribosomal protein S11 [Burkholderia sp. Ch1-1]
 gi|307585766|gb|ADN59164.1| 30S ribosomal protein S11 [Burkholderia sp. CCGE1003]
 gi|323384580|gb|ADX56671.1| 30S ribosomal protein S11 [Burkholderia sp. CCGE1001]
          Length = 134

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 86/123 (69%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R+R + +KN+  G  HV ++FNNT ITITD  GN +AW++    GF GSRK++PFAAQVA
Sbjct: 12  RVRKKVKKNVAEGVVHVHASFNNTIITITDRQGNALAWATSGGQGFKGSRKSTPFAAQVA 71

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +     A  +G+ +LEV++ G G GR+SA+RAL  +G  I +I DVT + HNGCRP KR
Sbjct: 72  AESAGRVAMEYGVKNLEVRIKGPGPGRESAVRALHGLGIKITAISDVTPVPHNGCRPPKR 131

Query: 127 RRI 129
           RRI
Sbjct: 132 RRI 134


>gi|16762866|ref|NP_458483.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29144353|ref|NP_807695.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213052885|ref|ZP_03345763.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213419636|ref|ZP_03352702.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213425774|ref|ZP_03358524.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213580696|ref|ZP_03362522.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213612394|ref|ZP_03370220.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213647331|ref|ZP_03377384.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213856916|ref|ZP_03384156.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|25009160|sp|Q8Z1X5|RS11_SALTI RecName: Full=30S ribosomal protein S11
 gi|25294671|pir||AH1008 30S ribosomal chain protein S11 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16505173|emb|CAD09169.1| 30S ribosomal subunit protein S11 [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139991|gb|AAO71555.1| 30S ribosomal subunit protein S11 [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 129

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 88/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P   R R RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPVCARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|167587748|ref|ZP_02380136.1| ribosomal protein S11 [Burkholderia ubonensis Bu]
          Length = 133

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 86/124 (69%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
            R+R + +KN+  G  HV ++FNNT ITITD  GN +AW++    GF GSRK++PFAAQV
Sbjct: 10  QRVRKKVKKNVAEGVVHVHASFNNTIITITDRQGNALAWATSGGQGFKGSRKSTPFAAQV 69

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +     A  +G+ +LEV++ G G GR+SA+RAL  +G  I +I DVT + HNGCRP K
Sbjct: 70  AAESAGRVAMEYGVKNLEVRIKGPGPGRESAVRALHGLGIKITAISDVTPVPHNGCRPPK 129

Query: 126 RRRI 129
           RRRI
Sbjct: 130 RRRI 133


>gi|308070948|ref|YP_003872553.1| 30S ribosomal protein S11 [Paenibacillus polymyxa E681]
 gi|305860227|gb|ADM72015.1| 30S ribosomal protein S11 [Paenibacillus polymyxa E681]
          Length = 131

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 94/128 (73%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK   R + R+RKNI +G AH+ STFNNT +TITDPHGN I+W+S   +GF GSRK++PF
Sbjct: 4   PKKVVRTKRRDRKNIETGVAHIRSTFNNTIVTITDPHGNAISWASSGGMGFRGSRKSTPF 63

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ+A +  +  A  HGM ++EV V G GAGR++A+R+L+A G  +  I DVT + HNGC
Sbjct: 64  AAQMAAETAAKAAMEHGMKTVEVMVKGPGAGREAAIRSLQAAGLEVNLIKDVTPVPHNGC 123

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 124 RPPKRRRV 131


>gi|169630851|ref|YP_001704500.1| 30S ribosomal protein S11 [Mycobacterium abscessus ATCC 19977]
 gi|226708389|sp|B1MGA1|RS11_MYCA9 RecName: Full=30S ribosomal protein S11
 gi|169242818|emb|CAM63846.1| 30S ribosomal protein S11 [Mycobacterium abscessus]
          Length = 138

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 94/128 (73%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK   + R RE+KN+  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++PF
Sbjct: 11  PKKAQKTRRREKKNVPHGAAHIKSTFNNTIVSITDPQGNVISWASSGHVGFKGSRKSTPF 70

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ+A ++ + KAQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGC
Sbjct: 71  AAQLAAENAARKAQEHGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGAISDVTPQPHNGC 130

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 131 RPPKRRRV 138


>gi|138893809|ref|YP_001124262.1| 30S ribosomal protein S11 [Geobacillus thermodenitrificans NG80-2]
 gi|196250998|ref|ZP_03149680.1| ribosomal protein S11 [Geobacillus sp. G11MC16]
 gi|152060591|sp|A4IJL3|RS11_GEOTN RecName: Full=30S ribosomal protein S11
 gi|134265322|gb|ABO65517.1| SSU ribosomal protein S11P [Geobacillus thermodenitrificans NG80-2]
 gi|196209470|gb|EDY04247.1| ribosomal protein S11 [Geobacillus sp. G11MC16]
          Length = 129

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/121 (58%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R RKNI +G AH+ STFNNT +TITD HGN IAWSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVRKNIDTGIAHIRSTFNNTIVTITDVHGNAIAWSSAGALGFKGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  +  HGM ++EV V G GAGR++A+RAL+A G  I +I DVT I HNGCRP KRRR
Sbjct: 69  AAAKASMEHGMKTVEVNVKGPGAGREAAIRALQAAGLEITAIKDVTPIPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|296394892|ref|YP_003659776.1| 30S ribosomal protein S11 [Segniliparus rotundus DSM 44985]
 gi|296182039|gb|ADG98945.1| 30S ribosomal protein S11 [Segniliparus rotundus DSM 44985]
          Length = 134

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 94/123 (76%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R RE+KNI +G AH+ STFNNT ++ITDP GN IAW+S   VGF GSRK++PFAAQ+A
Sbjct: 12  KVRRREKKNIPNGAAHIKSTFNNTIVSITDPEGNVIAWASSGHVGFKGSRKSTPFAAQLA 71

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            ++ + KAQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGCRP KR
Sbjct: 72  AENAARKAQEHGLKKVDVFVKGPGSGRETAIRSLQAAGLEVGNISDVTPQPHNGCRPPKR 131

Query: 127 RRI 129
           RR+
Sbjct: 132 RRV 134


>gi|156310433|ref|XP_001617742.1| hypothetical protein NEMVEDRAFT_v1g156831 [Nematostella vectensis]
 gi|156195586|gb|EDO25642.1| predicted protein [Nematostella vectensis]
          Length = 125

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 89/123 (72%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R+R + RKNI  G AHV ++FNNT ITITD  GN ++W+S    GF GSRK++PFAAQVA
Sbjct: 3   RVRKKVRKNISDGIAHVHASFNNTIITITDRQGNALSWASSGGQGFKGSRKSTPFAAQVA 62

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
           ++     A   G+ +L+V++ G G GR+S++RAL A+G  I SI DVT + HNGCRP+KR
Sbjct: 63  SEVAGRAAIEQGIKNLDVEIKGPGPGRESSVRALGALGIRITSIADVTPVPHNGCRPQKR 122

Query: 127 RRI 129
           RRI
Sbjct: 123 RRI 125


>gi|51894184|ref|YP_076875.1| 30S ribosomal protein S11 [Symbiobacterium thermophilum IAM 14863]
 gi|59798668|sp|Q67JW9|RS11_SYMTH RecName: Full=30S ribosomal protein S11
 gi|51857873|dbj|BAD42031.1| Ribosomal protein S11 [Symbiobacterium thermophilum IAM 14863]
          Length = 129

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 93/129 (72%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R++ RERKN+  G AH+ STFNNT +TITD HGN +AW++   +GF GSRK++P
Sbjct: 1   MAKRTARVKRRERKNVDKGVAHIRSTFNNTIVTITDVHGNALAWATAGAMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  +  A  HG+  +EV V G G+GR++A+R L+A G  + +I DVT I HNG
Sbjct: 61  FAAQMAAEKAAKDAMEHGVREVEVLVKGPGSGREAAIRQLQAAGLEVTAIKDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|271962662|ref|YP_003336858.1| 30S ribosomal protein S11 [Streptosporangium roseum DSM 43021]
 gi|270505837|gb|ACZ84115.1| ribosomal protein S11 [Streptosporangium roseum DSM 43021]
          Length = 134

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 95/126 (75%)

Query: 4   SPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAA 63
           +P ++R +E+KN+  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++PFAA
Sbjct: 9   APKKVRRKEKKNVAHGHAHIKSTFNNTIVSITDPSGNVISWASAGHVGFKGSRKSTPFAA 68

Query: 64  QVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRP 123
           Q+A ++ + +A  HGM  ++V V G G+GR++A+R+L+A G  + SI DVT + HNGCRP
Sbjct: 69  QMAAENAARRAMEHGMRKVDVFVKGPGSGRETAIRSLQATGLEVGSIQDVTPVPHNGCRP 128

Query: 124 RKRRRI 129
            KRRR+
Sbjct: 129 PKRRRV 134


>gi|323141380|ref|ZP_08076271.1| 30S ribosomal protein S11 [Phascolarctobacterium sp. YIT 12067]
 gi|322414129|gb|EFY04957.1| 30S ribosomal protein S11 [Phascolarctobacterium sp. YIT 12067]
          Length = 130

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 85/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+++G AH+ STFNNT +TI D  GN ++W+S   +GF GSRK++PFAAQ+A ++ +  A
Sbjct: 16  NVINGVAHIRSTFNNTIVTIADTEGNVLSWASAGGLGFRGSRKSTPFAAQMAAEEATKAA 75

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+  +EV V G GAGR++A+RAL+A G  + SI DVT I HNGCRP KRRR+
Sbjct: 76  MEHGLKQVEVYVKGPGAGREAAIRALQAAGLEVNSIKDVTPIPHNGCRPPKRRRV 130


>gi|149926590|ref|ZP_01914850.1| 30S ribosomal protein S11 [Limnobacter sp. MED105]
 gi|149824519|gb|EDM83735.1| 30S ribosomal protein S11 [Limnobacter sp. MED105]
          Length = 131

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 87/124 (70%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R R + +KNI  G AHV ++FNNT ITITD  GN +AWS+    GF GSRK++PFAAQV
Sbjct: 8   NRARKKVKKNISDGIAHVHASFNNTIITITDRQGNALAWSTSGAQGFKGSRKSTPFAAQV 67

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +     AQ  G+ ++EV + G G GR+S++RAL A+G  + SI D+T I HNGCRP K
Sbjct: 68  AAEVAGKAAQECGIKTVEVLIKGPGPGRESSVRALNALGIKVTSISDITPIPHNGCRPPK 127

Query: 126 RRRI 129
           RRRI
Sbjct: 128 RRRI 131


>gi|315925229|ref|ZP_07921443.1| 30S ribosomal protein S11 [Pseudoramibacter alactolyticus ATCC
           23263]
 gi|315621463|gb|EFV01430.1| 30S ribosomal protein S11 [Pseudoramibacter alactolyticus ATCC
           23263]
          Length = 130

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/130 (50%), Positives = 92/130 (70%), Gaps = 1/130 (0%)

Query: 1   MPKSPSRIRNRE-RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           M K   R + R+ +KNI  G+ H+ S+FNNT +TITD  GN ++W+S   +GF GS+K++
Sbjct: 1   MAKKAVRSKKRKIKKNIERGQVHIQSSFNNTIVTITDTAGNALSWASAGEMGFRGSKKST 60

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           PFAAQ+A++  +  A  HG+ S+EV V G G+GR++A+RAL+A G  I  I DVT I HN
Sbjct: 61  PFAAQMASEQAAKLAMEHGLRSVEVNVKGPGSGREAAIRALQAAGLEITVIRDVTPIPHN 120

Query: 120 GCRPRKRRRI 129
           GCRP KRRR+
Sbjct: 121 GCRPPKRRRV 130


>gi|254449330|ref|ZP_05062775.1| ribosomal protein S11 [gamma proteobacterium HTCC5015]
 gi|198261089|gb|EDY85389.1| ribosomal protein S11 [gamma proteobacterium HTCC5015]
          Length = 128

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 62/125 (49%), Positives = 88/125 (70%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P+R R + R+ +  G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++PFAAQ
Sbjct: 4   PTRTRKKNRRTVTEGVAHIYASFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTPFAAQ 63

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           VA +     A+ +G+ +L+V+V G G GR+SA+RAL  +GF I  I DVT + HNGCRP 
Sbjct: 64  VAAERAGDAAKEYGLKNLDVEVKGPGPGRESAVRALNNVGFKISHIKDVTPLPHNGCRPS 123

Query: 125 KRRRI 129
           KRRR+
Sbjct: 124 KRRRV 128


>gi|5913930|dbj|BAA84523.1| ribosomal protein S11 [Shewanella violacea]
          Length = 135

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/126 (53%), Positives = 89/126 (70%), Gaps = 1/126 (0%)

Query: 1   MPKSPSR-IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           M KSPSR  R R RK +  G AH+ ++FNNT ITITD  GN ++W++    GF GSRK++
Sbjct: 1   MAKSPSRSPRKRVRKQVADGMAHIHASFNNTIITITDRQGNALSWATSGGSGFRGSRKST 60

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           PFAAQVA +     AQ++G+ +LEV V G G GR+SA+RAL ++G+ I +I DVT I HN
Sbjct: 61  PFAAQVAAERAGVAAQDYGVKNLEVFVKGPGPGRESAIRALNSVGYKITNITDVTPIPHN 120

Query: 120 GCRPRK 125
           GCRP K
Sbjct: 121 GCRPPK 126


>gi|77361712|ref|YP_341287.1| 30S ribosomal protein S11 [Pseudoalteromonas haloplanktis TAC125]
 gi|119472062|ref|ZP_01614320.1| 30S ribosomal subunit protein S11 [Alteromonadales bacterium TW-7]
 gi|315127933|ref|YP_004069936.1| 30S ribosomal protein S11 [Pseudoalteromonas sp. SM9913]
 gi|91207671|sp|Q3IJK7|RS11_PSEHT RecName: Full=30S ribosomal protein S11
 gi|76876623|emb|CAI87845.1| 30S ribosomal subunit protein S11 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|119445197|gb|EAW26489.1| 30S ribosomal subunit protein S11 [Alteromonadales bacterium TW-7]
 gi|315016447|gb|ADT69785.1| 30S ribosomal protein S11 [Pseudoalteromonas sp. SM9913]
 gi|332037270|gb|EGI73725.1| 30S ribosomal protein S11 [Pseudoalteromonas haloplanktis ANT/505]
          Length = 128

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 90/129 (69%), Gaps = 1/129 (0%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R + +K +  G AHV ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKTPIR-RKKVKKQVADGMAHVHASFNNTIVTITDRQGNALSWATAGGSGFRGSRKSTP 59

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     AQ +G+ +LEV + G G GR+SA+RAL A G+ I +I DVT I HNG
Sbjct: 60  FAAQVAAERAGTAAQEYGLKNLEVFIKGPGPGRESAVRALNAAGYRITNITDVTPIPHNG 119

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 120 CRPPKKRRV 128


>gi|317505827|ref|ZP_07963672.1| 30S ribosomal protein S11 [Segniliparus rugosus ATCC BAA-974]
 gi|316255909|gb|EFV15134.1| 30S ribosomal protein S11 [Segniliparus rugosus ATCC BAA-974]
          Length = 134

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 94/123 (76%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R RE+KN+ +G AH+ STFNNT ++ITDP GN IAW+S   VGF GSRK++PFAAQ+A
Sbjct: 12  KVRRREKKNVPNGAAHIKSTFNNTIVSITDPEGNVIAWASSGHVGFKGSRKSTPFAAQLA 71

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            ++ + KAQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGCRP KR
Sbjct: 72  AENAARKAQEHGLKKVDVFVKGPGSGRETAIRSLQAAGLEVGNISDVTPQPHNGCRPPKR 131

Query: 127 RRI 129
           RR+
Sbjct: 132 RRV 134


>gi|328955887|ref|YP_004373220.1| SSU ribosomal protein S11P [Coriobacterium glomerans PW2]
 gi|328456211|gb|AEB07405.1| SSU ribosomal protein S11P [Coriobacterium glomerans PW2]
          Length = 134

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/125 (56%), Positives = 91/125 (72%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P+R++  ERKNI  G+AH+ STFNNT I+ITDP GN I W S   VGF GSRK++PFAAQ
Sbjct: 10  PTRVKRAERKNIAVGQAHIRSTFNNTIISITDPQGNVITWRSSGTVGFKGSRKSTPFAAQ 69

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           +A + C+  A  HGM  + V V G G+GR++A+R+L+A G  I SI D T I HNGCRP+
Sbjct: 70  MAAEACAKAAMEHGMHKVAVFVKGPGSGRETAIRSLQAAGLEIASIQDKTPIPHNGCRPK 129

Query: 125 KRRRI 129
           KRRR+
Sbjct: 130 KRRRV 134


>gi|310941693|dbj|BAJ24200.1| 30S ribosomal protein S11 [Pseudomonas alcaligenes]
          Length = 129

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R R + +K +V G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKPAARTRKKVKKTVVDGIAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     A  +G+ +L+V V G G GR+SA+RAL A G+ I SI DVT I HNG
Sbjct: 61  FAAQVAAERAGQAALEYGLKNLDVNVKGPGPGRESAVRALNACGYKIASITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|32491315|ref|NP_871569.1| 30S ribosomal protein S11 [Wigglesworthia glossinidia endosymbiont
           of Glossina brevipalpis]
 gi|29337189|sp|P59380|RS11_WIGBR RecName: Full=30S ribosomal protein S11
 gi|25166522|dbj|BAC24712.1| rpsK [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 131

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 87/121 (71%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R + ++ I+ G AH+ ++FNNT +TITD  GNT+ W++    GF GSRK++PFAAQVA +
Sbjct: 11  RKKIKRQILEGIAHIHASFNNTIVTITDRQGNTLGWATSGGSGFRGSRKSTPFAAQVAAE 70

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
            CS  A+ +G+ +LE+ V G G GR+S +RAL + GF I +I DVT I HNGCRP KRRR
Sbjct: 71  KCSEIAKEYGIKNLEIMVKGPGPGRESTIRALNSSGFKITNITDVTPIPHNGCRPPKRRR 130

Query: 129 I 129
           +
Sbjct: 131 V 131


>gi|289450236|ref|YP_003475757.1| 30S ribosomal protein S11 [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
 gi|289184783|gb|ADC91208.1| 30S ribosomal protein S11 [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
          Length = 133

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/124 (55%), Positives = 92/124 (74%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R + RERKN++SG AH+ S+FNNT +TITDP GN I+W+S   +G  GSRK +PFAAQ+
Sbjct: 10  ARPKKRERKNVISGAAHIHSSFNNTIVTITDPAGNAISWASAGGMGMKGSRKGTPFAAQM 69

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  +  A +HGM ++EV V G G+GR+SA+RAL+A G  +  I DVT I HNGCRP K
Sbjct: 70  AAEQAAKTAADHGMKNVEVYVKGPGSGRESAIRALQAAGLEVTMIKDVTPIPHNGCRPPK 129

Query: 126 RRRI 129
           RRR+
Sbjct: 130 RRRV 133


>gi|24371852|ref|NP_715894.1| 30S ribosomal protein S11 [Shewanella oneidensis MR-1]
 gi|113968567|ref|YP_732360.1| 30S ribosomal protein S11 [Shewanella sp. MR-4]
 gi|114045730|ref|YP_736280.1| 30S ribosomal protein S11 [Shewanella sp. MR-7]
 gi|117918680|ref|YP_867872.1| 30S ribosomal protein S11 [Shewanella sp. ANA-3]
 gi|120597012|ref|YP_961586.1| 30S ribosomal protein S11 [Shewanella sp. W3-18-1]
 gi|126176332|ref|YP_001052481.1| 30S ribosomal protein S11 [Shewanella baltica OS155]
 gi|146294818|ref|YP_001185242.1| 30S ribosomal protein S11 [Shewanella putrefaciens CN-32]
 gi|152998772|ref|YP_001364453.1| 30S ribosomal protein S11 [Shewanella baltica OS185]
 gi|160873348|ref|YP_001552664.1| 30S ribosomal protein S11 [Shewanella baltica OS195]
 gi|217975178|ref|YP_002359929.1| 30S ribosomal protein S11 [Shewanella baltica OS223]
 gi|304412787|ref|ZP_07394389.1| 30S ribosomal protein S11 [Shewanella baltica OS183]
 gi|307307451|ref|ZP_07587186.1| 30S ribosomal protein S11 [Shewanella baltica BA175]
 gi|48474282|sp|P59375|RS11_SHEON RecName: Full=30S ribosomal protein S11
 gi|122944218|sp|Q0HNR4|RS11_SHESM RecName: Full=30S ribosomal protein S11
 gi|122945055|sp|Q0I082|RS11_SHESR RecName: Full=30S ribosomal protein S11
 gi|152060821|sp|A0KRP7|RS11_SHESA RecName: Full=30S ribosomal protein S11
 gi|152060822|sp|A1RED7|RS11_SHESW RecName: Full=30S ribosomal protein S11
 gi|166231832|sp|A3DA49|RS11_SHEB5 RecName: Full=30S ribosomal protein S11
 gi|166231833|sp|A6WHV1|RS11_SHEB8 RecName: Full=30S ribosomal protein S11
 gi|166231834|sp|A4YBW0|RS11_SHEPC RecName: Full=30S ribosomal protein S11
 gi|189040435|sp|A9KWC4|RS11_SHEB9 RecName: Full=30S ribosomal protein S11
 gi|254811042|sp|B8EBI2|RS11_SHEB2 RecName: Full=30S ribosomal protein S11
 gi|24345669|gb|AAN53339.1|AE015474_2 ribosomal protein S11 [Shewanella oneidensis MR-1]
 gi|110812359|gb|ABG91715.1| ribosomal protein S11 [Shewanella putrefaciens 200]
 gi|113883251|gb|ABI37303.1| SSU ribosomal protein S11P [Shewanella sp. MR-4]
 gi|113887172|gb|ABI41223.1| SSU ribosomal protein S11P [Shewanella sp. MR-7]
 gi|117611012|gb|ABK46466.1| SSU ribosomal protein S11P [Shewanella sp. ANA-3]
 gi|120557105|gb|ABM23032.1| SSU ribosomal protein S11P [Shewanella sp. W3-18-1]
 gi|125999537|gb|ABN63612.1| SSU ribosomal protein S11P [Shewanella baltica OS155]
 gi|145566508|gb|ABP77443.1| SSU ribosomal protein S11P [Shewanella putrefaciens CN-32]
 gi|151363390|gb|ABS06390.1| ribosomal protein S11 [Shewanella baltica OS185]
 gi|160858870|gb|ABX47404.1| ribosomal protein S11 [Shewanella baltica OS195]
 gi|217500313|gb|ACK48506.1| ribosomal protein S11 [Shewanella baltica OS223]
 gi|304348867|gb|EFM13283.1| 30S ribosomal protein S11 [Shewanella baltica OS183]
 gi|306910239|gb|EFN40672.1| 30S ribosomal protein S11 [Shewanella baltica BA175]
 gi|315265576|gb|ADT92429.1| 30S ribosomal protein S11 [Shewanella baltica OS678]
 gi|319424603|gb|ADV52677.1| 30S ribosomal protein S11 [Shewanella putrefaciens 200]
          Length = 130

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 70/130 (53%), Positives = 93/130 (71%), Gaps = 1/130 (0%)

Query: 1   MPKSPSR-IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           M K PSR  R R RK +  G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++
Sbjct: 1   MAKVPSRSPRKRVRKQVADGMAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKST 60

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           PFAAQVA +   A AQ++G+ +LEV V G G GR+SA+RAL A+G+ I +I DVT I HN
Sbjct: 61  PFAAQVAAERAGAAAQDYGLKNLEVFVKGPGPGRESAIRALNAVGYKITNITDVTPIPHN 120

Query: 120 GCRPRKRRRI 129
           GCRP K+RR+
Sbjct: 121 GCRPPKKRRV 130


>gi|332178479|gb|AEE14168.1| 30S ribosomal protein S11 [Thermodesulfobium narugense DSM 14796]
          Length = 134

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 89/127 (70%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           ++ +R++ +E+KN++ G AH+ STFNNT I I+D  G  I+W S    GF G++K +P+A
Sbjct: 8   QTQTRVKKKEKKNVLYGIAHIHSTFNNTIIAISDKQGALISWGSGGTAGFKGTKKGTPYA 67

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  + KA +HGM  ++V V G G GR++A+R+L A G +I  I DVT I HNGCR
Sbjct: 68  AQLAAEVVAKKAMDHGMKQVDVYVKGPGPGRETAIRSLLAAGLSIEMIKDVTPIPHNGCR 127

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 128 PPKRRRV 134


>gi|16801817|ref|NP_472085.1| 30S ribosomal protein S11 [Listeria innocua Clip11262]
 gi|16804645|ref|NP_466130.1| 30S ribosomal protein S11 [Listeria monocytogenes EGD-e]
 gi|46908779|ref|YP_015168.1| 30S ribosomal protein S11 [Listeria monocytogenes str. 4b F2365]
 gi|47093973|ref|ZP_00231707.1| ribosomal protein S11 [Listeria monocytogenes str. 4b H7858]
 gi|47097178|ref|ZP_00234743.1| ribosomal protein S11 [Listeria monocytogenes str. 1/2a F6854]
 gi|116873973|ref|YP_850754.1| 30S ribosomal protein S11 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217966194|ref|YP_002351872.1| ribosomal protein S11 [Listeria monocytogenes HCC23]
 gi|224499280|ref|ZP_03667629.1| 30S ribosomal protein S11 [Listeria monocytogenes Finland 1988]
 gi|224503599|ref|ZP_03671906.1| 30S ribosomal protein S11 [Listeria monocytogenes FSL R2-561]
 gi|226225153|ref|YP_002759260.1| ribosomal protein S11 [Listeria monocytogenes Clip81459]
 gi|254825032|ref|ZP_05230033.1| ribosomal protein S11 [Listeria monocytogenes FSL J1-194]
 gi|254829056|ref|ZP_05233743.1| ribosomal protein S11 [Listeria monocytogenes FSL N3-165]
 gi|254830962|ref|ZP_05235617.1| 30S ribosomal protein S11 [Listeria monocytogenes 10403S]
 gi|254854188|ref|ZP_05243536.1| rpsK [Listeria monocytogenes FSL R2-503]
 gi|254899942|ref|ZP_05259866.1| 30S ribosomal protein S11 [Listeria monocytogenes J0161]
 gi|254912852|ref|ZP_05262864.1| 30S ribosomal protein S11 [Listeria monocytogenes J2818]
 gi|254931123|ref|ZP_05264482.1| rpsK [Listeria monocytogenes HPB2262]
 gi|254937232|ref|ZP_05268929.1| ribosomal protein S11 [Listeria monocytogenes F6900]
 gi|254992727|ref|ZP_05274917.1| 30S ribosomal protein S11 [Listeria monocytogenes FSL J2-064]
 gi|255027532|ref|ZP_05299518.1| 30S ribosomal protein S11 [Listeria monocytogenes FSL J2-003]
 gi|255028408|ref|ZP_05300359.1| 30S ribosomal protein S11 [Listeria monocytogenes LO28]
 gi|255520568|ref|ZP_05387805.1| 30S ribosomal protein S11 [Listeria monocytogenes FSL J1-175]
 gi|284800507|ref|YP_003412372.1| 30S ribosomal protein S11 [Listeria monocytogenes 08-5578]
 gi|284993693|ref|YP_003415461.1| 30S ribosomal protein S11 [Listeria monocytogenes 08-5923]
 gi|290891792|ref|ZP_06554789.1| ribosomal protein S11 [Listeria monocytogenes FSL J2-071]
 gi|300763642|ref|ZP_07073640.1| ribosomal protein S11 [Listeria monocytogenes FSL N1-017]
 gi|315283814|ref|ZP_07871883.1| 30S ribosomal protein S11 [Listeria marthii FSL S4-120]
 gi|315304918|ref|ZP_07875022.1| 30S ribosomal protein S11 [Listeria ivanovii FSL F6-596]
 gi|54039331|sp|P66353|RS11_LISIN RecName: Full=30S ribosomal protein S11
 gi|54042108|sp|P66352|RS11_LISMO RecName: Full=30S ribosomal protein S11
 gi|59798757|sp|Q71WH1|RS11_LISMF RecName: Full=30S ribosomal protein S11
 gi|123461448|sp|A0ALU3|RS11_LISW6 RecName: Full=30S ribosomal protein S11
 gi|254810702|sp|B8DB33|RS11_LISMH RecName: Full=30S ribosomal protein S11
 gi|259494628|sp|C1KZF6|RS11_LISMC RecName: Full=30S ribosomal protein S11
 gi|16412095|emb|CAD00685.1| ribosomal protein S11 [Listeria monocytogenes EGD-e]
 gi|16415292|emb|CAC97982.1| ribosomal protein S11 [Listeria innocua Clip11262]
 gi|46882052|gb|AAT05345.1| ribosomal protein S11 [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47014437|gb|EAL05405.1| ribosomal protein S11 [Listeria monocytogenes str. 1/2a F6854]
 gi|47017634|gb|EAL08433.1| ribosomal protein S11 [Listeria monocytogenes str. 4b H7858]
 gi|116742851|emb|CAK21975.1| ribosomal protein S11 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217335464|gb|ACK41258.1| ribosomal protein S11 [Listeria monocytogenes HCC23]
 gi|225877615|emb|CAS06329.1| ribosomal protein S11 [Listeria monocytogenes serotype 4b str. CLIP
           80459]
 gi|258601465|gb|EEW14790.1| ribosomal protein S11 [Listeria monocytogenes FSL N3-165]
 gi|258607580|gb|EEW20188.1| rpsK [Listeria monocytogenes FSL R2-503]
 gi|258609837|gb|EEW22445.1| ribosomal protein S11 [Listeria monocytogenes F6900]
 gi|284056069|gb|ADB67010.1| 30S ribosomal protein S11 [Listeria monocytogenes 08-5578]
 gi|284059160|gb|ADB70099.1| 30S ribosomal protein S11 [Listeria monocytogenes 08-5923]
 gi|290558386|gb|EFD91903.1| ribosomal protein S11 [Listeria monocytogenes FSL J2-071]
 gi|293582671|gb|EFF94703.1| rpsK [Listeria monocytogenes HPB2262]
 gi|293590850|gb|EFF99184.1| 30S ribosomal protein S11 [Listeria monocytogenes J2818]
 gi|293594274|gb|EFG02035.1| ribosomal protein S11 [Listeria monocytogenes FSL J1-194]
 gi|300515919|gb|EFK42968.1| ribosomal protein S11 [Listeria monocytogenes FSL N1-017]
 gi|307572196|emb|CAR85375.1| rpsK [Listeria monocytogenes L99]
 gi|313606574|gb|EFR83375.1| 30S ribosomal protein S11 [Listeria monocytogenes FSL F2-208]
 gi|313612541|gb|EFR86614.1| 30S ribosomal protein S11 [Listeria marthii FSL S4-120]
 gi|313616943|gb|EFR89578.1| 30S ribosomal protein S11 [Listeria innocua FSL S4-378]
 gi|313626709|gb|EFR95738.1| 30S ribosomal protein S11 [Listeria ivanovii FSL F6-596]
 gi|328468091|gb|EGF39097.1| 30S ribosomal protein S11 [Listeria monocytogenes 1816]
 gi|328469779|gb|EGF40696.1| 30S ribosomal protein S11 [Listeria monocytogenes 220]
          Length = 129

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI SG AH+ STFNNT + ITD HGN +AWSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVKKNIESGIAHIRSTFNNTIVMITDTHGNALAWSSAGSLGFKGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  AQ HG+ +LEV V G G+GR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  SAAKSAQEHGLKTLEVTVKGPGSGREAAIRALQAAGLEVTAIKDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|319778701|ref|YP_004129614.1| SSU ribosomal protein S11p (S14e) [Taylorella equigenitalis MCE9]
 gi|317108725|gb|ADU91471.1| SSU ribosomal protein S11p (S14e) [Taylorella equigenitalis MCE9]
          Length = 132

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 89/126 (70%)

Query: 4   SPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAA 63
           S +R R + RK +  G AHV ++FNNT ITITD  GN ++W++    GF GSRK++PFAA
Sbjct: 7   SATRARKKVRKVVSEGIAHVHASFNNTIITITDRQGNALSWATSGGAGFKGSRKSTPFAA 66

Query: 64  QVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRP 123
           QVA +     A  +G+SSL+V++ G G GR+S++RAL A+G  I SI D+T + HNGCRP
Sbjct: 67  QVAAESAGRVAMEYGISSLDVRIKGPGPGRESSVRALNALGIKITSISDITPVPHNGCRP 126

Query: 124 RKRRRI 129
            KRRRI
Sbjct: 127 PKRRRI 132


>gi|221126763|ref|XP_002164994.1| PREDICTED: hypothetical protein [Hydra magnipapillata]
 gi|260222205|emb|CBA31535.1| 30S ribosomal protein S11 [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 134

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 68/134 (50%), Positives = 93/134 (69%), Gaps = 5/134 (3%)

Query: 1   MPKSPS-----RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGS 55
           M K+P+     R+R + RKN+  G AHV ++FNNT ITITD  GN ++W+S    GF GS
Sbjct: 1   MAKAPANNAAQRVRKKVRKNVADGIAHVHASFNNTIITITDRQGNALSWASSGGQGFKGS 60

Query: 56  RKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTM 115
           RK++PFAAQVA++     A   G+ +L+V++ G G GR+S++RAL A+G  I  I DVT 
Sbjct: 61  RKSTPFAAQVASEVAGRAALEQGIKNLDVEIKGPGPGRESSVRALAALGIRINMIADVTP 120

Query: 116 IAHNGCRPRKRRRI 129
           + HNGCRP+KRRRI
Sbjct: 121 VPHNGCRPQKRRRI 134


>gi|304405590|ref|ZP_07387249.1| 30S ribosomal protein S11 [Paenibacillus curdlanolyticus YK9]
 gi|304345629|gb|EFM11464.1| 30S ribosomal protein S11 [Paenibacillus curdlanolyticus YK9]
          Length = 131

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 93/128 (72%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK   R + R+RKNI +G AH+ STFNNT +TITDPHGN I+W+S   +GF GSRK++PF
Sbjct: 4   PKKVVRTKRRDRKNIDTGVAHIRSTFNNTIVTITDPHGNAISWASSGNLGFKGSRKSTPF 63

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ+A +  +  A  HGM  +EV V G GAGR++A+R+L+A G  +  I DVT + HNGC
Sbjct: 64  AAQMAAETAAKAAMEHGMKVVEVMVKGPGAGREAAIRSLQAAGLEVNLIKDVTPVPHNGC 123

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 124 RPPKRRRV 131


>gi|212637980|ref|YP_002314500.1| 30S ribosomal protein S11 [Anoxybacillus flavithermus WK1]
 gi|226708325|sp|B7GJ93|RS11_ANOFW RecName: Full=30S ribosomal protein S11
 gi|212559460|gb|ACJ32515.1| Ribosomal protein S11 [Anoxybacillus flavithermus WK1]
          Length = 129

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI SG AH+ STFNNT +TITD HGN I+WSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVKKNIESGIAHIRSTFNNTIVTITDVHGNAISWSSAGALGFKGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  +  HGM ++EV V G GAGR++A+RAL+A G  I +I DVT + HNGCRP KRRR
Sbjct: 69  AAAKASMEHGMKTVEVNVKGPGAGREAAIRALQAAGLEITAIKDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|218289980|ref|ZP_03494157.1| ribosomal protein S11 [Alicyclobacillus acidocaldarius LAA1]
 gi|258512644|ref|YP_003186078.1| 30S ribosomal protein S11 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|218239965|gb|EED07152.1| ribosomal protein S11 [Alicyclobacillus acidocaldarius LAA1]
 gi|257479370|gb|ACV59689.1| 30S ribosomal protein S11 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 138

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 91/124 (73%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R R R+RKNI  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++P+AAQ+
Sbjct: 15  ARPRRRDRKNIEVGVAHIKSTFNNTIVSITDPAGNVISWASAGTVGFKGSRKSTPYAAQL 74

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  +  A  HGM S+EV V G GAGR++A+R+L+A G  I  I DVT I HNGCRP K
Sbjct: 75  AAEAAARSAMEHGMKSVEVLVKGPGAGREAAIRSLQAAGLEITGIRDVTPIPHNGCRPPK 134

Query: 126 RRRI 129
           RRR+
Sbjct: 135 RRRV 138


>gi|330430073|gb|AEC21407.1| 30S ribosomal protein S11 [Pusillimonas sp. T7-7]
          Length = 133

 Score =  134 bits (338), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 89/124 (71%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           SR+R + +K++  G AHV ++FNNT ITITD  GN ++W++    GF GSRK++PFAAQV
Sbjct: 10  SRVRKKIKKSVSDGIAHVHASFNNTIITITDRQGNALSWATSGGAGFKGSRKSTPFAAQV 69

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +     A  +G+ +LEV++ G G GR+S++RAL A+G  I SI D+T + HNGCRP K
Sbjct: 70  AAESAGRVALEYGIKTLEVRIKGPGPGRESSVRALNALGIKISSISDITPVPHNGCRPPK 129

Query: 126 RRRI 129
           RRRI
Sbjct: 130 RRRI 133


>gi|300309480|ref|YP_003773572.1| 30S ribosomal protein S11 [Herbaspirillum seropedicae SmR1]
 gi|300072265|gb|ADJ61664.1| 30S ribosomal subunit S11 protein [Herbaspirillum seropedicae SmR1]
          Length = 134

 Score =  134 bits (338), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 90/134 (67%), Gaps = 5/134 (3%)

Query: 1   MPKSP-----SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGS 55
           M KSP     SR+R + +KN+  G AHV ++FNNT ITITD  GN ++W++    GF GS
Sbjct: 1   MAKSPNNAAASRVRKKVKKNVAEGIAHVHASFNNTIITITDRQGNALSWATSGGAGFKGS 60

Query: 56  RKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTM 115
           RK++PFAAQVA +     A   G+ +LEV++ G G GR+SA+RAL  +G  I  I DVT 
Sbjct: 61  RKSTPFAAQVAAESAGKVAIECGIKNLEVRIKGPGPGRESAVRALNNLGIKITQIQDVTP 120

Query: 116 IAHNGCRPRKRRRI 129
           + HNGCRP KRRRI
Sbjct: 121 VPHNGCRPPKRRRI 134


>gi|146308900|ref|YP_001189365.1| 30S ribosomal protein S11 [Pseudomonas mendocina ymp]
 gi|330505184|ref|YP_004382053.1| 30S ribosomal protein S11 [Pseudomonas mendocina NK-01]
 gi|166231824|sp|A4XZ67|RS11_PSEMY RecName: Full=30S ribosomal protein S11
 gi|145577101|gb|ABP86633.1| SSU ribosomal protein S11P [Pseudomonas mendocina ymp]
 gi|310941843|dbj|BAJ24275.1| 30S ribosomal protein S11 [Pseudomonas mendocina]
 gi|328919470|gb|AEB60301.1| 30S ribosomal protein S11 [Pseudomonas mendocina NK-01]
          Length = 129

 Score =  134 bits (338), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 64/129 (49%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R R + +K +V G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKPAARTRKKVKKTVVDGIAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +     A  +G+ +L+V V G G GR+SA+RAL A G+ I SI DVT I HNG
Sbjct: 61  FAAQIAAERAGQAALEYGLKNLDVNVKGPGPGRESAVRALNACGYKIASITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|322381102|ref|ZP_08055105.1| 30S ribosomal protein S11-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321154678|gb|EFX46949.1| 30S ribosomal protein S11-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 131

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 71/123 (57%), Positives = 91/123 (73%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R + R+RKNI SG AH+ STFNNT +TITDPHGN I+W+S   +GF GSRK++PFAAQ+A
Sbjct: 9   RTKRRDRKNIESGVAHIRSTFNNTIVTITDPHGNAISWASSGNLGFKGSRKSTPFAAQMA 68

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  +  A  HGM  +EV V G GAGR++A+R+L+A G  +  I DVT I HNGCRP KR
Sbjct: 69  AETAAKAAMEHGMKVVEVMVKGPGAGREAAIRSLQAAGLEVNLIKDVTPIPHNGCRPPKR 128

Query: 127 RRI 129
           RR+
Sbjct: 129 RRV 131


>gi|50843285|ref|YP_056512.1| 30S ribosomal protein S11 [Propionibacterium acnes KPA171202]
 gi|282855172|ref|ZP_06264504.1| 30S ribosomal protein S11 [Propionibacterium acnes J139]
 gi|289424818|ref|ZP_06426600.1| 30S ribosomal protein S11 [Propionibacterium acnes SK187]
 gi|289427736|ref|ZP_06429448.1| 30S ribosomal protein S11 [Propionibacterium acnes J165]
 gi|295131354|ref|YP_003582017.1| 30S ribosomal protein S11 [Propionibacterium acnes SK137]
 gi|59798677|sp|Q6A6Q9|RS11_PROAC RecName: Full=30S ribosomal protein S11
 gi|50840887|gb|AAT83554.1| 30S ribosomal protein S11 [Propionibacterium acnes KPA171202]
 gi|282581760|gb|EFB87145.1| 30S ribosomal protein S11 [Propionibacterium acnes J139]
 gi|289154781|gb|EFD03464.1| 30S ribosomal protein S11 [Propionibacterium acnes SK187]
 gi|289159227|gb|EFD07419.1| 30S ribosomal protein S11 [Propionibacterium acnes J165]
 gi|291375834|gb|ADD99688.1| 30S ribosomal protein S11 [Propionibacterium acnes SK137]
 gi|313763205|gb|EFS34569.1| 30S ribosomal protein S11 [Propionibacterium acnes HL013PA1]
 gi|313773120|gb|EFS39086.1| 30S ribosomal protein S11 [Propionibacterium acnes HL074PA1]
 gi|313793290|gb|EFS41348.1| 30S ribosomal protein S11 [Propionibacterium acnes HL110PA1]
 gi|313801066|gb|EFS42334.1| 30S ribosomal protein S11 [Propionibacterium acnes HL110PA2]
 gi|313808807|gb|EFS47261.1| 30S ribosomal protein S11 [Propionibacterium acnes HL087PA2]
 gi|313810399|gb|EFS48113.1| 30S ribosomal protein S11 [Propionibacterium acnes HL083PA1]
 gi|313812265|gb|EFS49979.1| 30S ribosomal protein S11 [Propionibacterium acnes HL025PA1]
 gi|313816542|gb|EFS54256.1| 30S ribosomal protein S11 [Propionibacterium acnes HL059PA1]
 gi|313817986|gb|EFS55700.1| 30S ribosomal protein S11 [Propionibacterium acnes HL046PA2]
 gi|313819899|gb|EFS57613.1| 30S ribosomal protein S11 [Propionibacterium acnes HL036PA1]
 gi|313823390|gb|EFS61104.1| 30S ribosomal protein S11 [Propionibacterium acnes HL036PA2]
 gi|313824861|gb|EFS62575.1| 30S ribosomal protein S11 [Propionibacterium acnes HL063PA1]
 gi|313828397|gb|EFS66111.1| 30S ribosomal protein S11 [Propionibacterium acnes HL063PA2]
 gi|313832625|gb|EFS70339.1| 30S ribosomal protein S11 [Propionibacterium acnes HL056PA1]
 gi|313837981|gb|EFS75695.1| 30S ribosomal protein S11 [Propionibacterium acnes HL086PA1]
 gi|314914364|gb|EFS78195.1| 30S ribosomal protein S11 [Propionibacterium acnes HL005PA4]
 gi|314917684|gb|EFS81515.1| 30S ribosomal protein S11 [Propionibacterium acnes HL050PA1]
 gi|314919584|gb|EFS83415.1| 30S ribosomal protein S11 [Propionibacterium acnes HL050PA3]
 gi|314924149|gb|EFS87980.1| 30S ribosomal protein S11 [Propionibacterium acnes HL001PA1]
 gi|314925756|gb|EFS89587.1| 30S ribosomal protein S11 [Propionibacterium acnes HL036PA3]
 gi|314930174|gb|EFS94005.1| 30S ribosomal protein S11 [Propionibacterium acnes HL067PA1]
 gi|314957153|gb|EFT01257.1| 30S ribosomal protein S11 [Propionibacterium acnes HL027PA1]
 gi|314957794|gb|EFT01897.1| 30S ribosomal protein S11 [Propionibacterium acnes HL002PA1]
 gi|314960836|gb|EFT04937.1| 30S ribosomal protein S11 [Propionibacterium acnes HL002PA2]
 gi|314963510|gb|EFT07610.1| 30S ribosomal protein S11 [Propionibacterium acnes HL082PA1]
 gi|314964878|gb|EFT08977.1| 30S ribosomal protein S11 [Propionibacterium acnes HL082PA2]
 gi|314969907|gb|EFT14005.1| 30S ribosomal protein S11 [Propionibacterium acnes HL037PA1]
 gi|314973048|gb|EFT17144.1| 30S ribosomal protein S11 [Propionibacterium acnes HL053PA1]
 gi|314975544|gb|EFT19639.1| 30S ribosomal protein S11 [Propionibacterium acnes HL045PA1]
 gi|314979767|gb|EFT23861.1| 30S ribosomal protein S11 [Propionibacterium acnes HL072PA2]
 gi|314982286|gb|EFT26379.1| 30S ribosomal protein S11 [Propionibacterium acnes HL110PA3]
 gi|314984827|gb|EFT28919.1| 30S ribosomal protein S11 [Propionibacterium acnes HL005PA1]
 gi|314986086|gb|EFT30178.1| 30S ribosomal protein S11 [Propionibacterium acnes HL005PA2]
 gi|314988701|gb|EFT32792.1| 30S ribosomal protein S11 [Propionibacterium acnes HL005PA3]
 gi|315077131|gb|EFT49198.1| 30S ribosomal protein S11 [Propionibacterium acnes HL053PA2]
 gi|315079818|gb|EFT51794.1| 30S ribosomal protein S11 [Propionibacterium acnes HL078PA1]
 gi|315083185|gb|EFT55161.1| 30S ribosomal protein S11 [Propionibacterium acnes HL027PA2]
 gi|315086861|gb|EFT58837.1| 30S ribosomal protein S11 [Propionibacterium acnes HL002PA3]
 gi|315089953|gb|EFT61929.1| 30S ribosomal protein S11 [Propionibacterium acnes HL072PA1]
 gi|315090475|gb|EFT62451.1| 30S ribosomal protein S11 [Propionibacterium acnes HL110PA4]
 gi|315096725|gb|EFT68701.1| 30S ribosomal protein S11 [Propionibacterium acnes HL038PA1]
 gi|315097953|gb|EFT69929.1| 30S ribosomal protein S11 [Propionibacterium acnes HL059PA2]
 gi|315100596|gb|EFT72572.1| 30S ribosomal protein S11 [Propionibacterium acnes HL046PA1]
 gi|315104000|gb|EFT75976.1| 30S ribosomal protein S11 [Propionibacterium acnes HL050PA2]
 gi|315106039|gb|EFT78015.1| 30S ribosomal protein S11 [Propionibacterium acnes HL030PA1]
 gi|315109199|gb|EFT81175.1| 30S ribosomal protein S11 [Propionibacterium acnes HL030PA2]
 gi|327325139|gb|EGE66945.1| 30S ribosomal protein S11 [Propionibacterium acnes HL096PA3]
 gi|327325232|gb|EGE67037.1| 30S ribosomal protein S11 [Propionibacterium acnes HL096PA2]
 gi|327325528|gb|EGE67327.1| 30S ribosomal protein S11 [Propionibacterium acnes HL103PA1]
 gi|327332741|gb|EGE74475.1| 30S ribosomal protein S11 [Propionibacterium acnes HL097PA1]
 gi|327444032|gb|EGE90686.1| 30S ribosomal protein S11 [Propionibacterium acnes HL043PA1]
 gi|327449340|gb|EGE95994.1| 30S ribosomal protein S11 [Propionibacterium acnes HL013PA2]
 gi|327449432|gb|EGE96086.1| 30S ribosomal protein S11 [Propionibacterium acnes HL043PA2]
 gi|327451454|gb|EGE98108.1| 30S ribosomal protein S11 [Propionibacterium acnes HL087PA3]
 gi|327451571|gb|EGE98225.1| 30S ribosomal protein S11 [Propionibacterium acnes HL092PA1]
 gi|327451858|gb|EGE98512.1| 30S ribosomal protein S11 [Propionibacterium acnes HL083PA2]
 gi|328752072|gb|EGF65688.1| 30S ribosomal protein S11 [Propionibacterium acnes HL087PA1]
 gi|328755530|gb|EGF69146.1| 30S ribosomal protein S11 [Propionibacterium acnes HL025PA2]
 gi|328756315|gb|EGF69931.1| 30S ribosomal protein S11 [Propionibacterium acnes HL020PA1]
 gi|328761351|gb|EGF74878.1| 30S ribosomal protein S11 [Propionibacterium acnes HL099PA1]
          Length = 135

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 92/124 (74%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +++R +E+KN+V+G+AH+ STFNNT I ITDP G  I+W+S   VGF GSRK++PFAAQ+
Sbjct: 12  TKVRRKEKKNVVAGQAHIKSTFNNTIIAITDPSGAVISWASAGTVGFKGSRKSTPFAAQM 71

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +    +A  HGM  ++V V G G+GR++A+R+L A+G  I  I DVT + HNGCRP K
Sbjct: 72  AAEAAGRRAMEHGMKRVDVFVKGPGSGRETAIRSLGAVGLEIGPISDVTPVPHNGCRPPK 131

Query: 126 RRRI 129
           RRR+
Sbjct: 132 RRRV 135


>gi|15828061|ref|NP_302324.1| 30S ribosomal protein S11 [Mycobacterium leprae TN]
 gi|221230538|ref|YP_002503954.1| 30S ribosomal protein S11 [Mycobacterium leprae Br4923]
 gi|7388114|sp|Q9X7A0|RS11_MYCLE RecName: Full=30S ribosomal protein S11
 gi|254811035|sp|B8ZSH8|RS11_MYCLB RecName: Full=30S ribosomal protein S11
 gi|4539114|emb|CAB39835.1| putative 30S ribosomal protein S11 [Mycobacterium leprae]
 gi|13093614|emb|CAC30914.1| 30S ribosomal protein S11 [Mycobacterium leprae]
 gi|219933645|emb|CAR72056.1| 30S ribosomal protein S11 [Mycobacterium leprae Br4923]
          Length = 138

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 70/128 (54%), Positives = 93/128 (72%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK   + R RE+KNI  G AH+ STFNNT +TITD  GN IAW+S   VGF GSRK++PF
Sbjct: 11  PKKGQKTRKREKKNIPYGAAHIKSTFNNTIVTITDQQGNVIAWASSGHVGFKGSRKSTPF 70

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ+A ++ + KAQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGC
Sbjct: 71  AAQLAAENAARKAQEHGVRKVDVFVMGPGSGRETAIRSLQAAGLEVGAISDVTPQPHNGC 130

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 131 RPPKRRRV 138


>gi|121997626|ref|YP_001002413.1| 30S ribosomal protein S11 [Halorhodospira halophila SL1]
 gi|152060593|sp|A1WV99|RS11_HALHL RecName: Full=30S ribosomal protein S11
 gi|121589031|gb|ABM61611.1| SSU ribosomal protein S11P [Halorhodospira halophila SL1]
          Length = 131

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 65/131 (49%), Positives = 95/131 (72%), Gaps = 2/131 (1%)

Query: 1   MPKSPSRI--RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKN 58
           M K+ SR   + + ++ +  G AH+ +TFNNT ITITD  GN ++W+S    GF GSRK+
Sbjct: 1   MAKASSRGGGKKKVKRTVSDGVAHINATFNNTLITITDRQGNALSWASAGGSGFKGSRKS 60

Query: 59  SPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAH 118
           +PFAAQVA++  +  AQ++G+ ++EV+V G G GR+SA+RAL A+G+ I +I DV+ I H
Sbjct: 61  TPFAAQVASETAARAAQDYGLKNVEVRVKGPGPGRESAVRALNAVGYRITNISDVSPIPH 120

Query: 119 NGCRPRKRRRI 129
           NGCRP K+RR+
Sbjct: 121 NGCRPPKKRRV 131


>gi|313830103|gb|EFS67817.1| 30S ribosomal protein S11 [Propionibacterium acnes HL007PA1]
          Length = 135

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 92/124 (74%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +++R +E+KN+V+G+AH+ STFNNT I ITDP G  I+W+S   VGF GSRK++PFAAQ+
Sbjct: 12  TKVRRKEKKNVVAGQAHIKSTFNNTIIAITDPSGAVISWASAGTVGFKGSRKSTPFAAQM 71

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +    +A  HGM  ++V V G G+GR++A+R+L A+G  I  I DVT + HNGCRP K
Sbjct: 72  AAEAAGRRAMEHGMKRVDVFVKGSGSGRETAIRSLGAVGLEIGPISDVTPVPHNGCRPPK 131

Query: 126 RRRI 129
           RRR+
Sbjct: 132 RRRV 135


>gi|15599436|ref|NP_252930.1| 30S ribosomal protein S11 [Pseudomonas aeruginosa PAO1]
 gi|116052275|ref|YP_788879.1| 30S ribosomal protein S11 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152983718|ref|YP_001346246.1| 30S ribosomal protein S11 [Pseudomonas aeruginosa PA7]
 gi|218889431|ref|YP_002438295.1| 30S ribosomal protein S11 [Pseudomonas aeruginosa LESB58]
 gi|226942801|ref|YP_002797874.1| 30S ribosomal protein S11 [Azotobacter vinelandii DJ]
 gi|254237104|ref|ZP_04930427.1| 30S ribosomal protein S11 [Pseudomonas aeruginosa C3719]
 gi|254242911|ref|ZP_04936233.1| 30S ribosomal protein S11 [Pseudomonas aeruginosa 2192]
 gi|296387203|ref|ZP_06876702.1| 30S ribosomal protein S11 [Pseudomonas aeruginosa PAb1]
 gi|313111394|ref|ZP_07797199.1| 30S ribosomal protein S11 [Pseudomonas aeruginosa 39016]
 gi|48474659|sp|Q9HWF8|RS11_PSEAE RecName: Full=30S ribosomal protein S11
 gi|122261424|sp|Q02T57|RS11_PSEAB RecName: Full=30S ribosomal protein S11
 gi|166231823|sp|A6UZL1|RS11_PSEA7 RecName: Full=30S ribosomal protein S11
 gi|226708403|sp|B7V666|RS11_PSEA8 RecName: Full=30S ribosomal protein S11
 gi|259494614|sp|C1DKN6|RS11_AZOVD RecName: Full=30S ribosomal protein S11
 gi|9950457|gb|AAG07628.1|AE004841_6 30S ribosomal protein S11 [Pseudomonas aeruginosa PAO1]
 gi|115587496|gb|ABJ13511.1| ribosomal protein S11 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169035|gb|EAZ54546.1| 30S ribosomal protein S11 [Pseudomonas aeruginosa C3719]
 gi|126196289|gb|EAZ60352.1| 30S ribosomal protein S11 [Pseudomonas aeruginosa 2192]
 gi|150958876|gb|ABR80901.1| 30S ribosomal protein S11 [Pseudomonas aeruginosa PA7]
 gi|218769654|emb|CAW25414.1| 30S ribosomal protein S11 [Pseudomonas aeruginosa LESB58]
 gi|226717728|gb|ACO76899.1| 30S ribosomal protein S11 [Azotobacter vinelandii DJ]
 gi|310883701|gb|EFQ42295.1| 30S ribosomal protein S11 [Pseudomonas aeruginosa 39016]
 gi|310941723|dbj|BAJ24215.1| 30S ribosomal protein S11 [Pseudomonas aeruginosa]
          Length = 129

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R R + +K +V G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKPAARPRKKVKKTVVDGIAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     A  +G+ +L+V V G G GR+SA+RAL A G+ I SI DVT I HNG
Sbjct: 61  FAAQVAAERAGQAALEYGLKNLDVNVKGPGPGRESAVRALNACGYKIASITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|295838430|ref|ZP_06825363.1| 30S ribosomal protein S11 [Streptomyces sp. SPB74]
 gi|302519633|ref|ZP_07271975.1| 30S ribosomal protein S11 [Streptomyces sp. SPB78]
 gi|318058102|ref|ZP_07976825.1| 30S ribosomal protein S11 [Streptomyces sp. SA3_actG]
 gi|318076045|ref|ZP_07983377.1| 30S ribosomal protein S11 [Streptomyces sp. SA3_actF]
 gi|197695772|gb|EDY42705.1| 30S ribosomal protein S11 [Streptomyces sp. SPB74]
 gi|302428528|gb|EFL00344.1| 30S ribosomal protein S11 [Streptomyces sp. SPB78]
          Length = 134

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 92/123 (74%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +E+KN+  G AH+ STFNNT I+ITDP GN I+W+S   VGF GSRK++PFAAQ+A
Sbjct: 12  KVRRKEKKNVAHGHAHIKSTFNNTIISITDPTGNVISWASAGHVGFKGSRKSTPFAAQMA 71

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +AQ HGM  ++V V G G+GR++A+R+L+A G  + SI DVT   HNGCRP KR
Sbjct: 72  AESAARRAQEHGMRKVDVFVKGPGSGRETAIRSLQATGLEVGSIQDVTPTPHNGCRPPKR 131

Query: 127 RRI 129
           RR+
Sbjct: 132 RRV 134


>gi|15617095|ref|NP_240308.1| 30S ribosomal protein S11 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219681847|ref|YP_002468233.1| 30S ribosomal protein S11 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219682402|ref|YP_002468786.1| 30S ribosomal protein S11 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|257471552|ref|ZP_05635551.1| 30S ribosomal protein S11 [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|11387082|sp|P57568|RS11_BUCAI RecName: Full=30S ribosomal protein S11
 gi|254765371|sp|B8D9S4|RS11_BUCA5 RecName: Full=30S ribosomal protein S11
 gi|254765372|sp|B8D826|RS11_BUCAT RecName: Full=30S ribosomal protein S11
 gi|25294661|pir||B84988 30S ribosomal protein S11 [imported] - Buchnera sp. (strain APS)
 gi|10039160|dbj|BAB13194.1| 30S ribosomal protein S11 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219622135|gb|ACL30291.1| 30S ribosomal protein S11 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219624690|gb|ACL30845.1| 30S ribosomal protein S11 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|311086223|gb|ADP66305.1| 30S ribosomal protein S11 [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086800|gb|ADP66881.1| 30S ribosomal protein S11 [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311087387|gb|ADP67467.1| 30S ribosomal protein S11 [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
 gi|311087884|gb|ADP67963.1| 30S ribosomal protein S11 [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 131

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 87/123 (70%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R R R +K I+ G AH+ ++FNNT +TITD  GN + W++    GF GSRK++PFAAQVA
Sbjct: 9   RTRKRVKKQILDGIAHIHASFNNTIVTITDRQGNALGWATSGGSGFRGSRKSTPFAAQVA 68

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            + C+   +++G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNGCRP K+
Sbjct: 69  AERCAEIVKDYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKK 128

Query: 127 RRI 129
           RR+
Sbjct: 129 RRV 131


>gi|89902966|ref|YP_525437.1| 30S ribosomal protein S11 [Rhodoferax ferrireducens T118]
 gi|123091014|sp|Q21QP7|RS11_RHOFD RecName: Full=30S ribosomal protein S11
 gi|89347703|gb|ABD71906.1| SSU ribosomal protein S11P [Rhodoferax ferrireducens T118]
          Length = 134

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 68/134 (50%), Positives = 93/134 (69%), Gaps = 5/134 (3%)

Query: 1   MPKSPS-----RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGS 55
           M K+P+     R+R + RKN+  G AHV ++FNNT ITITD  GN ++W+S    GF GS
Sbjct: 1   MAKAPASNAAQRVRKKVRKNVADGIAHVHASFNNTIITITDRQGNALSWASSGGQGFKGS 60

Query: 56  RKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTM 115
           RK++PFAAQVA++     A   G+ +L+V++ G G GR+S++RAL A+G  I  I DVT 
Sbjct: 61  RKSTPFAAQVASEVAGRAAIEQGVKNLDVEIKGPGPGRESSVRALAALGIRINMIADVTP 120

Query: 116 IAHNGCRPRKRRRI 129
           + HNGCRP+KRRRI
Sbjct: 121 VPHNGCRPQKRRRI 134


>gi|304413168|ref|ZP_07394641.1| 30S ribosomal subunit protein S11 [Candidatus Regiella insecticola
           LSR1]
 gi|304284011|gb|EFL92404.1| 30S ribosomal subunit protein S11 [Candidatus Regiella insecticola
           LSR1]
          Length = 129

 Score =  134 bits (337), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 88/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R R R +K I  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKPAARTRKRVKKQISDGVAHIHASFNNTIVTITDRQGNALGWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   ++ G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAESVKDCGIKNLEVMVKGPGPGRESTIRALNAAGFRITNIIDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|218135255|ref|ZP_03464059.1| hypothetical protein BACPEC_03160 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990640|gb|EEC56651.1| hypothetical protein BACPEC_03160 [Bacteroides pectinophilus ATCC
           43243]
          Length = 123

 Score =  134 bits (337), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KN+  G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GS+K++P+AAQ+A +
Sbjct: 3   KKRVKKNVEHGQAHIQSSFNNTIVTLTDAEGNALSWASAGGLGFRGSKKSTPYAAQMAAE 62

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ S++V V G G+GR++A+RAL A G T+ SI DVT + HNGCRP KRRR
Sbjct: 63  TATKAALIHGLKSVDVMVKGPGSGREAAIRALSAAGLTVTSIKDVTPVPHNGCRPPKRRR 122

Query: 129 I 129
           +
Sbjct: 123 V 123


>gi|86739321|ref|YP_479721.1| 30S ribosomal protein S11 [Frankia sp. CcI3]
 gi|123751488|sp|Q2JFF0|RS11_FRASC RecName: Full=30S ribosomal protein S11
 gi|86566183|gb|ABD09992.1| SSU ribosomal protein S11P [Frankia sp. CcI3]
          Length = 134

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 66/123 (53%), Positives = 93/123 (75%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +E+KN+  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++PFAAQ+A
Sbjct: 12  KVRRKEKKNVAHGHAHIKSTFNNTIVSITDPSGNVISWASAGHVGFKGSRKSTPFAAQMA 71

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            ++ + KAQ HGM  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGCRP KR
Sbjct: 72  AENAARKAQEHGMRKVDVFVKGPGSGRETAIRSLQAAGLEVGAIQDVTPTPHNGCRPPKR 131

Query: 127 RRI 129
           RR+
Sbjct: 132 RRV 134


>gi|89093592|ref|ZP_01166540.1| 30S ribosomal protein S11 [Oceanospirillum sp. MED92]
 gi|89082282|gb|EAR61506.1| 30S ribosomal protein S11 [Oceanospirillum sp. MED92]
          Length = 129

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R R + +K I  G AH+ ++FNNT ITITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKPGNRTRKKVKKQIADGFAHIHASFNNTIITITDRQGNALSWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     A  +G+ +L+V V G G GR+SA+RAL A+G+ I +I DVT I HNG
Sbjct: 61  FAAQVAAERAGQAALEYGLKNLDVFVKGPGPGRESAVRALNAVGYKIANITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|289579116|ref|YP_003477743.1| 30S ribosomal protein S11 [Thermoanaerobacter italicus Ab9]
 gi|297545303|ref|YP_003677605.1| 30S ribosomal protein S11 [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|289528829|gb|ADD03181.1| 30S ribosomal protein S11 [Thermoanaerobacter italicus Ab9]
 gi|296843078|gb|ADH61594.1| 30S ribosomal protein S11 [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 130

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R RE+K++  G AH+ STFNNT +TITDP GNTI+W+S   +GF GSRK++PFAAQ+A +
Sbjct: 10  RKREKKHVERGIAHIHSTFNNTIVTITDPAGNTISWASAGTIGFKGSRKSTPFAAQMAAE 69

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HGM +++V V G GAGR++A+RAL+A G  +  I DVT I HNGCRP KRRR
Sbjct: 70  SAAKSAMEHGMKTVDVYVKGPGAGREAAIRALQAAGLEVSLIKDVTPIPHNGCRPPKRRR 129

Query: 129 I 129
           +
Sbjct: 130 V 130


>gi|17547714|ref|NP_521116.1| 30S ribosomal protein S11 [Ralstonia solanacearum GMI1000]
 gi|48474566|sp|Q8XV36|RS11_RALSO RecName: Full=30S ribosomal protein S11
 gi|17430019|emb|CAD16704.1| probable 30s ribosomal protein s11 [Ralstonia solanacearum GMI1000]
          Length = 133

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 86/124 (69%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
            R R + RKN+  G AHV ++FNNT ITITD  GN ++W++    GF GSRK++PFAAQV
Sbjct: 10  QRARKKVRKNVADGIAHVHASFNNTIITITDRQGNALSWATSGGQGFKGSRKSTPFAAQV 69

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +     AQ+ G+ +LEV++ G G GR+SA+RAL  +G  I  I DVT + HNGCRP K
Sbjct: 70  AAESAGRVAQDQGIKNLEVRIKGPGPGRESAVRALNNLGIKIQVIEDVTPVPHNGCRPPK 129

Query: 126 RRRI 129
           RRRI
Sbjct: 130 RRRI 133


>gi|167036827|ref|YP_001664405.1| 30S ribosomal protein S11 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|167039546|ref|YP_001662531.1| 30S ribosomal protein S11 [Thermoanaerobacter sp. X514]
 gi|256752658|ref|ZP_05493510.1| ribosomal protein S11 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300915203|ref|ZP_07132518.1| 30S ribosomal protein S11 [Thermoanaerobacter sp. X561]
 gi|307725127|ref|YP_003904878.1| 30S ribosomal protein S11 [Thermoanaerobacter sp. X513]
 gi|320115249|ref|YP_004185408.1| 30S ribosomal protein S11 [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|226708427|sp|B0KCM6|RS11_THEP3 RecName: Full=30S ribosomal protein S11
 gi|226708428|sp|B0K5R9|RS11_THEPX RecName: Full=30S ribosomal protein S11
 gi|166853786|gb|ABY92195.1| ribosomal protein S11 [Thermoanaerobacter sp. X514]
 gi|166855661|gb|ABY94069.1| ribosomal protein S11 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|256748478|gb|EEU61530.1| ribosomal protein S11 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300888927|gb|EFK84074.1| 30S ribosomal protein S11 [Thermoanaerobacter sp. X561]
 gi|307582188|gb|ADN55587.1| 30S ribosomal protein S11 [Thermoanaerobacter sp. X513]
 gi|319928340|gb|ADV79025.1| 30S ribosomal protein S11 [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 130

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R RE+K++  G AH+ STFNNT +TITDP GNTI+W+S   +GF GSRK++PFAAQ+A +
Sbjct: 10  RKREKKHVERGIAHIHSTFNNTIVTITDPAGNTISWASAGTIGFKGSRKSTPFAAQMAAE 69

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HGM +++V V G GAGR++A+RAL+A G  +  I DVT I HNGCRP KRRR
Sbjct: 70  SAAKSAMEHGMKTVDVYVKGPGAGREAAIRALQAAGLEVSLIKDVTPIPHNGCRPPKRRR 129

Query: 129 I 129
           +
Sbjct: 130 V 130


>gi|289641140|ref|ZP_06473308.1| ribosomal protein S11 [Frankia symbiont of Datisca glomerata]
 gi|289509081|gb|EFD30012.1| ribosomal protein S11 [Frankia symbiont of Datisca glomerata]
          Length = 134

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 66/123 (53%), Positives = 93/123 (75%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +E+KN+  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++PFAAQ+A
Sbjct: 12  KVRRKEKKNVAHGHAHIKSTFNNTIVSITDPSGNVISWASAGHVGFKGSRKSTPFAAQMA 71

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            ++ + KAQ HGM  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGCRP KR
Sbjct: 72  AENAARKAQEHGMRKVDVFVKGPGSGRETAIRSLQAAGLEVGAIQDVTPTPHNGCRPPKR 131

Query: 127 RRI 129
           RR+
Sbjct: 132 RRV 134


>gi|315093708|gb|EFT65684.1| 30S ribosomal protein S11 [Propionibacterium acnes HL060PA1]
          Length = 135

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 92/124 (74%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +++R +E+KN+V+G+AH+ STFNNT I ITDP G  ++W+S   VGF GSRK++PFAAQ+
Sbjct: 12  TKVRRKEKKNVVAGQAHIKSTFNNTIIAITDPSGAVVSWASAGTVGFKGSRKSTPFAAQM 71

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +    +A  HGM  ++V V G G+GR++A+R+L A+G  I  I DVT + HNGCRP K
Sbjct: 72  AAEAAGRRAMEHGMKRVDVFVKGPGSGRETAIRSLGAVGLEIGPISDVTPVPHNGCRPPK 131

Query: 126 RRRI 129
           RRR+
Sbjct: 132 RRRV 135


>gi|162446983|ref|YP_001620115.1| 30S ribosomal protein S11 [Acholeplasma laidlawii PG-8A]
 gi|189040400|sp|A9NEF9|RS11_ACHLI RecName: Full=30S ribosomal protein S11
 gi|161985090|gb|ABX80739.1| small subunit ribosomal protein S11 [Acholeplasma laidlawii PG-8A]
          Length = 130

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 87/120 (72%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R RKNI SG AH+ +TFNNT +TITDP GN I+WSS   +G  GSRK++PFAAQ+ ++
Sbjct: 10  KRRVRKNIPSGIAHIHTTFNNTIVTITDPAGNAISWSSAGALGIKGSRKSTPFAAQLTSE 69

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A ++GM+ +EV V G G GR++A+R+L+A G  I +I DVT + HNGCRP KR R
Sbjct: 70  AAAKGAMDNGMARVEVYVKGPGPGREAAIRSLQAAGLEITAIKDVTPVPHNGCRPPKRPR 129


>gi|118467427|ref|YP_885904.1| 30S ribosomal protein S11 [Mycobacterium smegmatis str. MC2 155]
 gi|152060795|sp|A0QSL6|RS11_MYCS2 RecName: Full=30S ribosomal protein S11
 gi|118168714|gb|ABK69610.1| ribosomal protein S11 [Mycobacterium smegmatis str. MC2 155]
          Length = 138

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 93/127 (73%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K   + R RE+KN+  G AH+ STFNNT ++ITDP GN IAW+S   VGF GSRK++PFA
Sbjct: 12  KKGQKTRRREKKNVPHGAAHIKSTFNNTIVSITDPQGNVIAWASSGHVGFKGSRKSTPFA 71

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A ++ + KAQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGCR
Sbjct: 72  AQLAAENAARKAQEHGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGTISDVTPQPHNGCR 131

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 132 PPKRRRV 138


>gi|118616623|ref|YP_904955.1| 30S ribosomal protein S11 [Mycobacterium ulcerans Agy99]
 gi|183981108|ref|YP_001849399.1| 30S ribosomal protein S11, RpsK [Mycobacterium marinum M]
 gi|152060798|sp|A0PMB5|RS11_MYCUA RecName: Full=30S ribosomal protein S11
 gi|226708390|sp|B2HCX2|RS11_MYCMM RecName: Full=30S ribosomal protein S11
 gi|118568733|gb|ABL03484.1| 30S ribosomal protein S11, RpsK [Mycobacterium ulcerans Agy99]
 gi|183174434|gb|ACC39544.1| 30S ribosomal protein S11, RpsK [Mycobacterium marinum M]
          Length = 138

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 69/128 (53%), Positives = 93/128 (72%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK   + R RE+KN+  G AH+ STFNNT +TITDP GN IAW+S   VGF GSRK++PF
Sbjct: 11  PKKGQKTRRREKKNVPHGAAHIKSTFNNTIVTITDPQGNVIAWASSGHVGFKGSRKSTPF 70

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ+A ++ + KAQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNG 
Sbjct: 71  AAQLAAENAARKAQEHGVRKVDVFVKGPGSGRETAIRSLQAAGLEVGAISDVTPQPHNGV 130

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 131 RPPKRRRV 138


>gi|56418667|ref|YP_145985.1| 30S ribosomal protein S11 [Geobacillus kaustophilus HTA426]
 gi|261417633|ref|YP_003251315.1| 30S ribosomal protein S11 [Geobacillus sp. Y412MC61]
 gi|297528508|ref|YP_003669783.1| 30S ribosomal protein S11 [Geobacillus sp. C56-T3]
 gi|319765291|ref|YP_004130792.1| 30S ribosomal protein S11 [Geobacillus sp. Y412MC52]
 gi|62287364|sp|Q5L3R3|RS11_GEOKA RecName: Full=30S ribosomal protein S11
 gi|56378509|dbj|BAD74417.1| 30S ribosomal protein S11 [Geobacillus kaustophilus HTA426]
 gi|261374090|gb|ACX76833.1| 30S ribosomal protein S11 [Geobacillus sp. Y412MC61]
 gi|297251760|gb|ADI25206.1| 30S ribosomal protein S11 [Geobacillus sp. C56-T3]
 gi|317110157|gb|ADU92649.1| 30S ribosomal protein S11 [Geobacillus sp. Y412MC52]
          Length = 129

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 70/121 (57%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R RKNI +G AH+ STFNNT +TITD HGN IAW+S   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVRKNIDTGIAHIRSTFNNTIVTITDVHGNAIAWASAGSLGFKGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  +  HGM ++EV V G GAGR++A+RAL+A G  I +I DVT I HNGCRP KRRR
Sbjct: 69  AAAKASMEHGMKTVEVNVKGPGAGREAAIRALQAAGLEITAIKDVTPIPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|20808634|ref|NP_623805.1| 30S ribosomal protein S11 [Thermoanaerobacter tengcongensis MB4]
 gi|46397718|sp|Q8R7Y0|RS11_THETN RecName: Full=30S ribosomal protein S11
 gi|20517268|gb|AAM25409.1| Ribosomal protein S11 [Thermoanaerobacter tengcongensis MB4]
          Length = 130

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 70/121 (57%), Positives = 91/121 (75%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R RE+K++  G AH+ STFNNT +TITDP GNTIAW+S   VGF GSRK++PFAAQ+A +
Sbjct: 10  RKREKKHVERGIAHIHSTFNNTIVTITDPAGNTIAWASAGTVGFKGSRKSTPFAAQMAAE 69

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A +HGM +++V V G GAGR++A+RAL+A G  +  I DVT I HNGCRP KRRR
Sbjct: 70  SAAKAAMDHGMRTVDVYVKGPGAGREAAIRALQAAGLEVSLIKDVTPIPHNGCRPPKRRR 129

Query: 129 I 129
           +
Sbjct: 130 V 130


>gi|83748173|ref|ZP_00945200.1| SSU ribosomal protein S11P [Ralstonia solanacearum UW551]
 gi|187930340|ref|YP_001900827.1| 30S ribosomal protein S11 [Ralstonia pickettii 12J]
 gi|207721873|ref|YP_002252311.1| 30S ribosomal protein S11 [Ralstonia solanacearum MolK2]
 gi|207744552|ref|YP_002260944.1| 30s ribosomal protein s11 [Ralstonia solanacearum IPO1609]
 gi|241664508|ref|YP_002982868.1| 30S ribosomal protein S11 [Ralstonia pickettii 12D]
 gi|300690184|ref|YP_003751179.1| 30S ribosomal subunit protein S11 [Ralstonia solanacearum PSI07]
 gi|300702804|ref|YP_003744405.1| 30S ribosomal protein S11 [Ralstonia solanacearum CFBP2957]
 gi|309782858|ref|ZP_07677578.1| 30S ribosomal protein S11 [Ralstonia sp. 5_7_47FAA]
 gi|226708405|sp|B2UEJ5|RS11_RALPJ RecName: Full=30S ribosomal protein S11
 gi|83725141|gb|EAP72292.1| SSU ribosomal protein S11P [Ralstonia solanacearum UW551]
 gi|187727230|gb|ACD28395.1| ribosomal protein S11 [Ralstonia pickettii 12J]
 gi|206587041|emb|CAQ17625.1| 30s ribosomal protein s11 [Ralstonia solanacearum MolK2]
 gi|206595958|emb|CAQ62885.1| 30s ribosomal protein s11 [Ralstonia solanacearum IPO1609]
 gi|240866535|gb|ACS64196.1| ribosomal protein S11 [Ralstonia pickettii 12D]
 gi|299065439|emb|CBJ36608.1| 30S ribosomal subunit protein S11 [Ralstonia solanacearum CMR15]
 gi|299070466|emb|CBJ41761.1| 30S ribosomal subunit protein S11 [Ralstonia solanacearum CFBP2957]
 gi|299077244|emb|CBJ49870.1| 30S ribosomal subunit protein S11 [Ralstonia solanacearum PSI07]
 gi|308918282|gb|EFP63959.1| 30S ribosomal protein S11 [Ralstonia sp. 5_7_47FAA]
          Length = 133

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 86/124 (69%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
            R R + RKN+  G AHV ++FNNT ITITD  GN ++W++    GF GSRK++PFAAQV
Sbjct: 10  QRARKKVRKNVADGIAHVHASFNNTIITITDRQGNALSWATSGGQGFKGSRKSTPFAAQV 69

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +     AQ+ G+ +LEV++ G G GR+SA+RAL  +G  I  I DVT + HNGCRP K
Sbjct: 70  AAESAGRVAQDQGIKNLEVRIKGPGPGRESAVRALNNLGIKIQLIEDVTPVPHNGCRPPK 129

Query: 126 RRRI 129
           RRRI
Sbjct: 130 RRRI 133


>gi|310941873|dbj|BAJ24290.1| 30S ribosomal protein S11 [Pseudomonas straminea]
          Length = 129

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 64/129 (49%), Positives = 88/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R R + +K +V G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKPAARTRKKVKKTVVDGIAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     A  +G+ +L+V V G G GR+SA+RAL   G+ I SI DVT I HNG
Sbjct: 61  FAAQVAAERAGQAALEYGLKNLDVNVKGPGPGRESAVRALNGCGYKIASITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPSKKRRV 129


>gi|296168683|ref|ZP_06850432.1| 30S ribosomal protein S11 [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295896592|gb|EFG76233.1| 30S ribosomal protein S11 [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 138

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 68/124 (54%), Positives = 92/124 (74%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
            + R RE+KNI  G AH+ STFNNT ++ITDP GN IAW+S   VGF GSRK++PFAAQ+
Sbjct: 15  QKTRKREKKNIPHGAAHIKSTFNNTIVSITDPQGNVIAWASSGHVGFKGSRKSTPFAAQL 74

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A ++ + KAQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGCRP K
Sbjct: 75  AAENAARKAQEHGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPK 134

Query: 126 RRRI 129
           RRR+
Sbjct: 135 RRRV 138


>gi|111220572|ref|YP_711366.1| 30S ribosomal protein S11 [Frankia alni ACN14a]
 gi|123143522|sp|Q0RRP5|RS11_FRAAA RecName: Full=30S ribosomal protein S11
 gi|111148104|emb|CAJ59772.1| 30S ribosomal subunit protein S11 [Frankia alni ACN14a]
          Length = 134

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 66/123 (53%), Positives = 93/123 (75%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +E+KN+  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++PFAAQ+A
Sbjct: 12  KVRRKEKKNVAHGHAHIKSTFNNTIVSITDPTGNVISWASAGHVGFKGSRKSTPFAAQMA 71

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            ++ + KAQ HGM  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGCRP KR
Sbjct: 72  AENAARKAQEHGMRKVDVFVKGPGSGRETAIRSLQAAGLEVGAIQDVTPTPHNGCRPPKR 131

Query: 127 RRI 129
           RR+
Sbjct: 132 RRV 134


>gi|29831495|ref|NP_826129.1| 30S ribosomal protein S11 [Streptomyces avermitilis MA-4680]
 gi|182436601|ref|YP_001824320.1| 30S ribosomal protein S11 [Streptomyces griseus subsp. griseus NBRC
           13350]
 gi|239929488|ref|ZP_04686441.1| 30S ribosomal protein S11 [Streptomyces ghanaensis ATCC 14672]
 gi|239943603|ref|ZP_04695540.1| 30S ribosomal protein S11 [Streptomyces roseosporus NRRL 15998]
 gi|239990056|ref|ZP_04710720.1| 30S ribosomal protein S11 [Streptomyces roseosporus NRRL 11379]
 gi|254383146|ref|ZP_04998500.1| 30S ribosomal protein S11 [Streptomyces sp. Mg1]
 gi|254391367|ref|ZP_05006570.1| 30S ribosomal protein S11 [Streptomyces clavuligerus ATCC 27064]
 gi|282860837|ref|ZP_06269903.1| ribosomal protein S11 [Streptomyces sp. ACTE]
 gi|290958125|ref|YP_003489307.1| 30S ribosomal protein S11 [Streptomyces scabiei 87.22]
 gi|291437813|ref|ZP_06577203.1| 30S ribosomal protein S11 [Streptomyces ghanaensis ATCC 14672]
 gi|291447070|ref|ZP_06586460.1| 30S ribosomal protein S11 [Streptomyces roseosporus NRRL 15998]
 gi|294630919|ref|ZP_06709479.1| 30S ribosomal protein S11 [Streptomyces sp. e14]
 gi|294814493|ref|ZP_06773136.1| 30S ribosomal protein S11 [Streptomyces clavuligerus ATCC 27064]
 gi|297192677|ref|ZP_06910075.1| 30S ribosomal protein S11 [Streptomyces pristinaespiralis ATCC
           25486]
 gi|297201755|ref|ZP_06919152.1| 30S ribosomal protein S11 [Streptomyces sviceus ATCC 29083]
 gi|302536277|ref|ZP_07288619.1| 30S ribosomal protein S11 [Streptomyces sp. C]
 gi|302553568|ref|ZP_07305910.1| 30S ribosomal protein S11 [Streptomyces viridochromogenes DSM
           40736]
 gi|326442882|ref|ZP_08217616.1| 30S ribosomal protein S11 [Streptomyces clavuligerus ATCC 27064]
 gi|326777223|ref|ZP_08236488.1| 30S ribosomal protein S11 [Streptomyces cf. griseus XylebKG-1]
 gi|34925208|sp|Q82DM3|RS11_STRAW RecName: Full=30S ribosomal protein S11
 gi|226708419|sp|B1W3Y1|RS11_STRGG RecName: Full=30S ribosomal protein S11
 gi|29608611|dbj|BAC72664.1| putative ribosomal protein S11 [Streptomyces avermitilis MA-4680]
 gi|178465117|dbj|BAG19637.1| putative 30S ribosomal protein S11 [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|194342045|gb|EDX23011.1| 30S ribosomal protein S11 [Streptomyces sp. Mg1]
 gi|197705057|gb|EDY50869.1| 30S ribosomal protein S11 [Streptomyces clavuligerus ATCC 27064]
 gi|197710870|gb|EDY54904.1| 30S ribosomal protein S11 [Streptomyces sviceus ATCC 29083]
 gi|197721668|gb|EDY65576.1| 30S ribosomal protein S11 [Streptomyces pristinaespiralis ATCC
           25486]
 gi|260647651|emb|CBG70756.1| 30S ribosomal protein S11 [Streptomyces scabiei 87.22]
 gi|282564573|gb|EFB70109.1| ribosomal protein S11 [Streptomyces sp. ACTE]
 gi|291340708|gb|EFE67664.1| 30S ribosomal protein S11 [Streptomyces ghanaensis ATCC 14672]
 gi|291350017|gb|EFE76921.1| 30S ribosomal protein S11 [Streptomyces roseosporus NRRL 15998]
 gi|292834252|gb|EFF92601.1| 30S ribosomal protein S11 [Streptomyces sp. e14]
 gi|294327092|gb|EFG08735.1| 30S ribosomal protein S11 [Streptomyces clavuligerus ATCC 27064]
 gi|302445172|gb|EFL16988.1| 30S ribosomal protein S11 [Streptomyces sp. C]
 gi|302471186|gb|EFL34279.1| 30S ribosomal protein S11 [Streptomyces viridochromogenes DSM
           40736]
 gi|320009076|gb|ADW03926.1| 30S ribosomal protein S11 [Streptomyces flavogriseus ATCC 33331]
 gi|326657556|gb|EGE42402.1| 30S ribosomal protein S11 [Streptomyces cf. griseus XylebKG-1]
 gi|328884453|emb|CCA57692.1| SSU ribosomal protein S11p [Streptomyces venezuelae ATCC 10712]
          Length = 134

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 66/123 (53%), Positives = 92/123 (74%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +E+KN+  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++PFAAQ+A
Sbjct: 12  KVRRKEKKNVAHGHAHIKSTFNNTIVSITDPSGNVISWASAGHVGFKGSRKSTPFAAQMA 71

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +AQ HGM  ++V V G G+GR++A+R+L+A G  + SI DVT   HNGCRP KR
Sbjct: 72  AESAARRAQEHGMRKVDVFVKGPGSGRETAIRSLQATGLEVGSIQDVTPTPHNGCRPPKR 131

Query: 127 RRI 129
           RR+
Sbjct: 132 RRV 134


>gi|119484810|ref|ZP_01619292.1| 30S ribosomal protein S11 [Lyngbya sp. PCC 8106]
 gi|119457628|gb|EAW38752.1| 30S ribosomal protein S11 [Lyngbya sp. PCC 8106]
          Length = 130

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 85/119 (71%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           ++++N+ +G A++ STFNNT +TITDP+G  I+W+S    GF G++K +PFAAQ A +  
Sbjct: 12  KQKRNVPNGVAYIQSTFNNTIVTITDPNGEVISWASAGSTGFKGAKKGTPFAAQTAAESA 71

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             +A + GM  +EV VSG GAGR++A+RAL+  G  I  I D+T I HNGCRP KRRR+
Sbjct: 72  GRRANDQGMRQIEVMVSGPGAGRETAIRALQGAGLEITLIRDITPIPHNGCRPPKRRRV 130


>gi|94676729|ref|YP_588799.1| 30S ribosomal protein S11 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|123384131|sp|Q1LTB5|RS11_BAUCH RecName: Full=30S ribosomal protein S11
 gi|94219879|gb|ABF14038.1| ribosomal protein S11 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 129

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+    R   +K +V G AH+ ++FNNT +TITD  GNT+ W++    GF GSRK++P
Sbjct: 1   MAKTILAARKHIKKQVVDGIAHIHASFNNTIVTITDRQGNTLGWATAGNSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   +++G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCAEAVKDYGIKNLEVMVKGPGPGRESTVRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|21223107|ref|NP_628886.1| 30S ribosomal protein S11 [Streptomyces coelicolor A3(2)]
 gi|239980030|ref|ZP_04702554.1| 30S ribosomal protein S11 [Streptomyces albus J1074]
 gi|256785797|ref|ZP_05524228.1| 30S ribosomal protein S11 [Streptomyces lividans TK24]
 gi|289769689|ref|ZP_06529067.1| 30S ribosomal protein S11 [Streptomyces lividans TK24]
 gi|291451887|ref|ZP_06591277.1| 30S ribosomal protein S11 [Streptomyces albus J1074]
 gi|302558968|ref|ZP_07311310.1| 30S ribosomal protein S11 [Streptomyces griseoflavus Tu4000]
 gi|329938206|ref|ZP_08287657.1| 30S ribosomal protein S11 [Streptomyces griseoaurantiacus M045]
 gi|6094148|sp|P72403|RS11_STRCO RecName: Full=30S ribosomal protein S11
 gi|3449240|emb|CAA20384.1| 30S ribosomal protein S11 [Streptomyces coelicolor A3(2)]
 gi|289699888|gb|EFD67317.1| 30S ribosomal protein S11 [Streptomyces lividans TK24]
 gi|291354836|gb|EFE81738.1| 30S ribosomal protein S11 [Streptomyces albus J1074]
 gi|302476586|gb|EFL39679.1| 30S ribosomal protein S11 [Streptomyces griseoflavus Tu4000]
 gi|329302695|gb|EGG46585.1| 30S ribosomal protein S11 [Streptomyces griseoaurantiacus M045]
          Length = 134

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 66/123 (53%), Positives = 92/123 (74%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +E+KN+  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++PFAAQ+A
Sbjct: 12  KVRRKEKKNVAHGHAHIKSTFNNTIVSITDPTGNVISWASAGHVGFKGSRKSTPFAAQMA 71

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +AQ HGM  ++V V G G+GR++A+R+L+A G  + SI DVT   HNGCRP KR
Sbjct: 72  AESAARRAQEHGMRKVDVFVKGPGSGRETAIRSLQATGLEVGSIQDVTPTPHNGCRPPKR 131

Query: 127 RRI 129
           RR+
Sbjct: 132 RRV 134


>gi|160942872|ref|ZP_02090111.1| hypothetical protein FAEPRAM212_00348 [Faecalibacterium prausnitzii
           M21/2]
 gi|158445773|gb|EDP22776.1| hypothetical protein FAEPRAM212_00348 [Faecalibacterium prausnitzii
           M21/2]
 gi|295103948|emb|CBL01492.1| SSU ribosomal protein S11P [Faecalibacterium prausnitzii SL3/3]
          Length = 136

 Score =  133 bits (335), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 89/123 (72%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R++ +ERKNI +G+AH+ STFNNT +TITD  GN ++W S   + F GSRK++PFAAQ A
Sbjct: 14  RMKRKERKNIAAGQAHIQSTFNNTVVTITDLQGNAVSWCSSGSLNFRGSRKSTPFAAQSA 73

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  +  A  HGM ++EV V G GAGR+SA+RAL+A G  +  I DVT I HNGCRP KR
Sbjct: 74  AETAAKTAIEHGMKTVEVYVKGPGAGRESAIRALQATGLEVTLIKDVTPIPHNGCRPPKR 133

Query: 127 RRI 129
           RR+
Sbjct: 134 RRV 136


>gi|326332225|ref|ZP_08198505.1| 30S ribosomal protein S11 [Nocardioidaceae bacterium Broad-1]
 gi|325949931|gb|EGD41991.1| 30S ribosomal protein S11 [Nocardioidaceae bacterium Broad-1]
          Length = 133

 Score =  133 bits (335), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 91/124 (73%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           ++IR +E+KN+  G AH+ STFNNT +TITDP G  I+W+S   VGF GSRK++PFAAQ+
Sbjct: 10  TKIRRKEKKNVAQGEAHIKSTFNNTIVTITDPTGAVISWASAGTVGFKGSRKSTPFAAQM 69

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +    +A +HGM  ++V V G G+GR++A+R+L AIG  + +I DVT   HNGCRP K
Sbjct: 70  AAEAAGRRAMDHGMKKIDVFVKGPGSGRETAIRSLGAIGLEVGTIQDVTPAPHNGCRPPK 129

Query: 126 RRRI 129
           RRR+
Sbjct: 130 RRRV 133


>gi|94266330|ref|ZP_01290032.1| Ribosomal protein S11 [delta proteobacterium MLMS-1]
 gi|93453084|gb|EAT03563.1| Ribosomal protein S11 [delta proteobacterium MLMS-1]
          Length = 131

 Score =  133 bits (335), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 65/128 (50%), Positives = 87/128 (67%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           P    R R ++RKNI  G   + STFNNT +T  DP GN I+W S   +GF GSRK++PF
Sbjct: 4   PSKTVRPRKKDRKNIPEGVCFIKSTFNNTIVTFADPAGNVISWCSSGCLGFKGSRKSTPF 63

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ A +    KAQ+HG+  +EV+V+G G GR+SA+RAL+A G  +  I D+T + HNGC
Sbjct: 64  AAQNAVETAVKKAQDHGLRKVEVRVNGPGPGRESAIRALQAAGVEVNFIRDMTPLPHNGC 123

Query: 122 RPRKRRRI 129
           +P KRRR+
Sbjct: 124 KPPKRRRV 131


>gi|302543335|ref|ZP_07295677.1| 30S ribosomal protein S11 [Streptomyces hygroscopicus ATCC 53653]
 gi|307328056|ref|ZP_07607237.1| 30S ribosomal protein S11 [Streptomyces violaceusniger Tu 4113]
 gi|297159623|gb|ADI09335.1| 30S ribosomal protein S11 [Streptomyces bingchenggensis BCW-1]
 gi|302460953|gb|EFL24046.1| 30S ribosomal protein S11 [Streptomyces himastatinicus ATCC 53653]
 gi|306886361|gb|EFN17366.1| 30S ribosomal protein S11 [Streptomyces violaceusniger Tu 4113]
          Length = 134

 Score =  133 bits (335), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 66/123 (53%), Positives = 92/123 (74%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +E+KN+  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++PFAAQ+A
Sbjct: 12  KVRRKEKKNVAHGHAHIKSTFNNTIVSITDPTGNVISWASAGHVGFKGSRKSTPFAAQMA 71

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +AQ HGM  ++V V G G+GR++A+R+L+A G  + SI DVT   HNGCRP KR
Sbjct: 72  AESAARRAQEHGMRKVDVFVKGPGSGRETAIRSLQATGLEVGSIQDVTPTPHNGCRPPKR 131

Query: 127 RRI 129
           RR+
Sbjct: 132 RRV 134


>gi|163938144|ref|YP_001643028.1| 30S ribosomal protein S11 [Bacillus weihenstephanensis KBAB4]
 gi|229009645|ref|ZP_04166871.1| 30S ribosomal protein S11 [Bacillus mycoides DSM 2048]
 gi|229053982|ref|ZP_04195416.1| 30S ribosomal protein S11 [Bacillus cereus AH603]
 gi|229131144|ref|ZP_04260056.1| 30S ribosomal protein S11 [Bacillus cereus BDRD-ST196]
 gi|229165124|ref|ZP_04292919.1| 30S ribosomal protein S11 [Bacillus cereus AH621]
 gi|226708331|sp|A9VPA3|RS11_BACWK RecName: Full=30S ribosomal protein S11
 gi|163860341|gb|ABY41400.1| ribosomal protein S11 [Bacillus weihenstephanensis KBAB4]
 gi|228618387|gb|EEK75417.1| 30S ribosomal protein S11 [Bacillus cereus AH621]
 gi|228652357|gb|EEL08282.1| 30S ribosomal protein S11 [Bacillus cereus BDRD-ST196]
 gi|228721400|gb|EEL72921.1| 30S ribosomal protein S11 [Bacillus cereus AH603]
 gi|228751667|gb|EEM01467.1| 30S ribosomal protein S11 [Bacillus mycoides DSM 2048]
          Length = 129

 Score =  133 bits (335), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT +T+TD HGN ++WSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KKRVKKNIEAGIAHIRSTFNNTIVTLTDTHGNALSWSSAGALGFRGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             S  A  HG+ +LEV V G GAGR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  AASKVAMEHGLKTLEVTVKGPGAGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|146281193|ref|YP_001171346.1| 30S ribosomal protein S11 [Pseudomonas stutzeri A1501]
 gi|152060810|sp|A4VHQ3|RS11_PSEU5 RecName: Full=30S ribosomal protein S11
 gi|145569398|gb|ABP78504.1| 30S ribosomal protein S11 [Pseudomonas stutzeri A1501]
 gi|310941903|dbj|BAJ24305.1| 30S ribosomal protein S11 [Pseudomonas stutzeri]
 gi|327479346|gb|AEA82656.1| 30S ribosomal protein S11 [Pseudomonas stutzeri DSM 4166]
          Length = 129

 Score =  133 bits (335), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 64/129 (49%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R R + +K +V G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKPAARPRKKVKKTVVDGIAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +     A  +G+ +L+V V G G GR+SA+RAL A G+ I SI DVT I HNG
Sbjct: 61  FAAQIAAERAGQAALEYGLKNLDVNVKGPGPGRESAVRALNACGYKIASITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|168704699|ref|ZP_02736976.1| 30S ribosomal protein S11 [Gemmata obscuriglobus UQM 2246]
          Length = 126

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + + R+N+  G AHV STFNNT +TITD +G+T+  SS   VGF GSRK++PFAAQ A +
Sbjct: 6   KKKTRRNVSRGVAHVQSTFNNTIVTITDTNGDTLCHSSGGAVGFKGSRKSTPFAAQRAAE 65

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           +C++KA   G+  +EV+V G GAGR+SA+ AL+A G  + +I DVT + HNGCRP K+RR
Sbjct: 66  ECASKASKFGVKEVEVRVKGPGAGRESAITALQASGLNVKAIEDVTPLPHNGCRPPKKRR 125

Query: 129 I 129
           +
Sbjct: 126 V 126


>gi|89100322|ref|ZP_01173187.1| 30S ribosomal protein S11 [Bacillus sp. NRRL B-14911]
 gi|89084943|gb|EAR64079.1| 30S ribosomal protein S11 [Bacillus sp. NRRL B-14911]
          Length = 129

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI SG AH+ STFNNT +TITD HGN ++WSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVKKNIESGIAHIRSTFNNTIVTITDVHGNALSWSSAGALGFRGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  +  HGM +LEV V G GAGR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TAAKTSMEHGMKTLEVTVKGPGAGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|330891909|gb|EGH24570.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. mori str.
           301020]
          Length = 129

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 64/129 (49%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+ +R R + +K +V G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKTAARPRKKVKKTVVDGIAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     A  +G+ +L+V V G G GR+SA+RAL   G+ I SI DVT I HNG
Sbjct: 61  FAAQVAAERAGQAALEYGLKNLDVNVKGPGPGRESAVRALNGCGYKIASITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|197117348|ref|YP_002137775.1| 30S ribosomal protein S11 [Geobacter bemidjiensis Bem]
 gi|253701897|ref|YP_003023086.1| 30S ribosomal protein S11 [Geobacter sp. M21]
 gi|322418389|ref|YP_004197612.1| 30S ribosomal protein S11 [Geobacter sp. M18]
 gi|197086708|gb|ACH37979.1| ribosomal protein S11 [Geobacter bemidjiensis Bem]
 gi|251776747|gb|ACT19328.1| ribosomal protein S11 [Geobacter sp. M21]
 gi|320124776|gb|ADW12336.1| 30S ribosomal protein S11 [Geobacter sp. M18]
          Length = 131

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 71/115 (61%), Positives = 87/115 (75%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI +G AH+ +TFNNT ITITDP GN +AW +    GF GSRK++PFAAQ+A +D + KA
Sbjct: 17  NIPNGVAHIQATFNNTMITITDPVGNVVAWCTSGAKGFKGSRKSTPFAAQMAAEDAAKKA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           Q HGM S+EV V G G+GR+SALRAL+A GF +  I DVT I HNGCRP KRRR+
Sbjct: 77  QEHGMRSIEVYVKGPGSGRESALRALQAAGFAVSFIRDVTPIPHNGCRPPKRRRV 131


>gi|196018040|ref|XP_002118718.1| hypothetical protein TRIADDRAFT_51242 [Trichoplax adhaerens]
 gi|190578391|gb|EDV18797.1| hypothetical protein TRIADDRAFT_51242 [Trichoplax adhaerens]
          Length = 122

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 62/118 (52%), Positives = 83/118 (70%)

Query: 12  ERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCS 71
           E+KNIV+G AH+ +TFNNT +TITD  G  +AWSS    GF GSRK++P+AAQV  ++ +
Sbjct: 5   EKKNIVAGVAHISATFNNTIVTITDTQGAVVAWSSAGSNGFKGSRKSTPYAAQVTAENVA 64

Query: 72  AKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            K    GM ++ VK+ G G GRDSA+R L + G  + +I D+T I HNGCRP KRRR+
Sbjct: 65  KKVTEFGMKTISVKIQGPGTGRDSAVRGLISSGLNVTTIKDITPIPHNGCRPPKRRRV 122


>gi|295694864|ref|YP_003588102.1| 30S ribosomal protein S11 [Bacillus tusciae DSM 2912]
 gi|295410466|gb|ADG04958.1| 30S ribosomal protein S11 [Bacillus tusciae DSM 2912]
          Length = 135

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 93/124 (75%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R++ R+RKNI +G AH+ STFNNT +TITD  GN I+W+S   VGF GSRK++PFAAQ+
Sbjct: 12  TRMKRRDRKNIEAGIAHIRSTFNNTIVTITDGAGNAISWASAGNVGFKGSRKSTPFAAQM 71

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A D  + KA  HGM ++EV V G GAGR++A+R+L+A G  +  I DVT I HNGCRP K
Sbjct: 72  AADSAARKAMEHGMRTVEVYVKGPGAGREAAIRSLQAAGLEVSLIKDVTPIPHNGCRPPK 131

Query: 126 RRRI 129
           RRR+
Sbjct: 132 RRRV 135


>gi|256371241|ref|YP_003109065.1| ribosomal protein S11 [Acidimicrobium ferrooxidans DSM 10331]
 gi|256007825|gb|ACU53392.1| ribosomal protein S11 [Acidimicrobium ferrooxidans DSM 10331]
          Length = 132

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 85/116 (73%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           K+I  G AH+ S+FNNT +TITDP GN IAW+S   VGF GSRK++PFAAQVA + C+ +
Sbjct: 17  KSIARGVAHIHSSFNNTIVTITDPAGNVIAWASSGNVGFKGSRKSTPFAAQVAGETCAKR 76

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           A  HG+  ++V + G G+GR++A +AL   G  I SI DVT + HNGCRP+KRRR+
Sbjct: 77  AMEHGVREVDVYLKGPGSGRETAHKALAGAGIEIRSIRDVTPVPHNGCRPKKRRRV 132


>gi|292492444|ref|YP_003527883.1| ribosomal protein S11 [Nitrosococcus halophilus Nc4]
 gi|291581039|gb|ADE15496.1| ribosomal protein S11 [Nitrosococcus halophilus Nc4]
          Length = 127

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 86/121 (71%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R ++ +V G AH+ ++FNNT +TITD  GNT+AW++    GF GSRK++PFAAQVA +
Sbjct: 7   KKRVKRVVVDGIAHIHASFNNTIVTITDRQGNTLAWATSGGSGFRGSRKSTPFAAQVAAE 66

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
                AQ  GM +LEV+V G G GR+SA RAL  +GF + +I DVT I HNGCRP K+RR
Sbjct: 67  KAGRVAQEMGMKNLEVRVKGPGPGRESAARALNNVGFKVTNIADVTPIPHNGCRPPKKRR 126

Query: 129 I 129
           +
Sbjct: 127 V 127


>gi|317050553|ref|YP_004111669.1| 30S ribosomal protein S11 [Desulfurispirillum indicum S5]
 gi|316945637|gb|ADU65113.1| 30S ribosomal protein S11 [Desulfurispirillum indicum S5]
          Length = 127

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 91/123 (73%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R R RE+KN+  G  H+ ++FNNT ITITDP GN ++W+S    GF GS+K++PFAAQVA
Sbjct: 5   RTRKREKKNVPKGVVHIKASFNNTLITITDPQGNAVSWNSAGSQGFKGSKKSTPFAAQVA 64

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            D  +  A +HGM  +EV+V G G+GR+S++RAL+A G  I+SI DVT I HNGCRP KR
Sbjct: 65  ADVAAKAAVDHGMKEVEVEVRGPGSGRESSIRALQAAGLRILSIKDVTPIPHNGCRPPKR 124

Query: 127 RRI 129
           RR+
Sbjct: 125 RRV 127


>gi|228478001|ref|ZP_04062612.1| 30S ribosomal protein S11 [Streptococcus salivarius SK126]
 gi|228250181|gb|EEK09434.1| 30S ribosomal protein S11 [Streptococcus salivarius SK126]
          Length = 127

 Score =  133 bits (335), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 93/125 (74%), Gaps = 1/125 (0%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P+R R R +KNI SG AH+ +TFNNT + ITD HGN +AWSS   +GF GSRK++PFAAQ
Sbjct: 4   PTRKR-RVKKNIESGIAHIHATFNNTIVMITDVHGNAVAWSSAGALGFKGSRKSTPFAAQ 62

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           +A++  +  AQ HG+ ++EV V G G+GR+SA+RAL A G  + +I DVT + HNGCRP 
Sbjct: 63  MASEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLEVTAIRDVTPVPHNGCRPP 122

Query: 125 KRRRI 129
           KRRR+
Sbjct: 123 KRRRV 127


>gi|332040529|gb|EGI76905.1| 30S ribosomal protein S11 [Hylemonella gracilis ATCC 19624]
          Length = 134

 Score =  133 bits (334), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 68/134 (50%), Positives = 93/134 (69%), Gaps = 5/134 (3%)

Query: 1   MPKSPS-----RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGS 55
           M K+P+     R+R + RKN+  G AHV ++FNNT ITITD  GN ++W+S    GF GS
Sbjct: 1   MAKAPANTAAQRVRKKVRKNVADGIAHVHASFNNTIITITDRQGNALSWASSGGQGFKGS 60

Query: 56  RKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTM 115
           RK++PFAAQVA++     A   G+ +L+V++ G G GR+S++RAL A+G  I  I DVT 
Sbjct: 61  RKSTPFAAQVASEVAGRAAIEQGIKNLDVEIKGPGPGRESSVRALAALGIRINLISDVTP 120

Query: 116 IAHNGCRPRKRRRI 129
           + HNGCRP+KRRRI
Sbjct: 121 MPHNGCRPQKRRRI 134


>gi|299820980|ref|ZP_07052869.1| 30S ribosomal protein S11 [Listeria grayi DSM 20601]
 gi|299818001|gb|EFI85236.1| 30S ribosomal protein S11 [Listeria grayi DSM 20601]
          Length = 129

 Score =  133 bits (334), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT + ITD HGN +AWSS   +GF GS+K++PFAAQ+A +
Sbjct: 9   KRRVKKNIEAGIAHIRSTFNNTIVMITDVHGNALAWSSAGALGFKGSKKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  AQ HG+ +LEV V G GAGR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  SAAKSAQEHGIKTLEVTVKGPGAGREAAIRALQAAGIEVTAIKDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|108798083|ref|YP_638280.1| 30S ribosomal protein S11 [Mycobacterium sp. MCS]
 gi|119867179|ref|YP_937131.1| 30S ribosomal protein S11 [Mycobacterium sp. KMS]
 gi|126433743|ref|YP_001069434.1| 30S ribosomal protein S11 [Mycobacterium sp. JLS]
 gi|123179359|sp|Q1BD10|RS11_MYCSS RecName: Full=30S ribosomal protein S11
 gi|152060796|sp|A3PVL6|RS11_MYCSJ RecName: Full=30S ribosomal protein S11
 gi|152060797|sp|A1UBY3|RS11_MYCSK RecName: Full=30S ribosomal protein S11
 gi|108768502|gb|ABG07224.1| SSU ribosomal protein S11P [Mycobacterium sp. MCS]
 gi|119693268|gb|ABL90341.1| SSU ribosomal protein S11P [Mycobacterium sp. KMS]
 gi|126233543|gb|ABN96943.1| SSU ribosomal protein S11P [Mycobacterium sp. JLS]
          Length = 138

 Score =  133 bits (334), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 92/124 (74%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
            + R RE+KN+  G AH+ STFNNT ++ITDP GN IAW+S   VGF GSRK++PFAAQ+
Sbjct: 15  QKTRRREKKNVPHGAAHIKSTFNNTIVSITDPQGNVIAWASSGHVGFKGSRKSTPFAAQL 74

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A ++ + KAQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGCRP K
Sbjct: 75  AAENAARKAQEHGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGAIADVTPQPHNGCRPPK 134

Query: 126 RRRI 129
           RRR+
Sbjct: 135 RRRV 138


>gi|226305368|ref|YP_002765326.1| 30S ribosomal protein S11 [Rhodococcus erythropolis PR4]
 gi|229489326|ref|ZP_04383189.1| 30S ribosomal protein S11 [Rhodococcus erythropolis SK121]
 gi|259494632|sp|C0ZW52|RS11_RHOE4 RecName: Full=30S ribosomal protein S11
 gi|226184483|dbj|BAH32587.1| 30S ribosomal protein S11 [Rhodococcus erythropolis PR4]
 gi|229323423|gb|EEN89181.1| 30S ribosomal protein S11 [Rhodococcus erythropolis SK121]
          Length = 137

 Score =  133 bits (334), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 93/128 (72%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK   + R R++KNI  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++PF
Sbjct: 10  PKKTQKTRRRDKKNIPHGAAHIKSTFNNTIVSITDPAGNVISWASSGHVGFKGSRKSTPF 69

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ+A +  + KAQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGC
Sbjct: 70  AAQLAAESAARKAQEHGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGTISDVTPQPHNGC 129

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 130 RPPKRRRV 137


>gi|284992848|ref|YP_003411402.1| 30S ribosomal protein S11 [Geodermatophilus obscurus DSM 43160]
 gi|284066093|gb|ADB77031.1| 30S ribosomal protein S11 [Geodermatophilus obscurus DSM 43160]
          Length = 135

 Score =  133 bits (334), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 92/122 (75%)

Query: 8   IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
           +R +E+KN+  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++PFAAQ+A 
Sbjct: 14  VRRKEKKNVAHGAAHIKSTFNNTIVSITDPTGNVISWASAGHVGFKGSRKSTPFAAQMAA 73

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
           ++ + KAQ HGM  ++V V G G+GR++A+R+L+A G  +  I DVT   HNGCRP+KRR
Sbjct: 74  ENAARKAQEHGMRKVDVFVKGPGSGRETAIRSLQATGLEVGQIQDVTPQPHNGCRPKKRR 133

Query: 128 RI 129
           R+
Sbjct: 134 RV 135


>gi|205372043|ref|ZP_03224860.1| 30S ribosomal protein S11 (BS11) [Bacillus coahuilensis m4-4]
          Length = 129

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT +TITD HGN ++WSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVKKNIEAGIAHIRSTFNNTIVTITDVHGNAVSWSSAGALGFRGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  +  HGM +LEV V G GAGR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TAAKTSMEHGMKTLEVTVKGPGAGREAAIRALQAAGLEVTAIKDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|21672747|ref|NP_660814.1| 30S ribosomal protein S11 [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
 gi|25009157|sp|Q8K972|RS11_BUCAP RecName: Full=30S ribosomal protein S11
 gi|21623393|gb|AAM68025.1| 30S ribosomal protein S11 [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
          Length = 130

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/126 (50%), Positives = 87/126 (69%)

Query: 4   SPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAA 63
           S  R R R +K I  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++PFAA
Sbjct: 5   SSVRTRKRVKKQITDGIAHIHASFNNTIVTITDRQGNALGWATSGGSGFRGSRKSTPFAA 64

Query: 64  QVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRP 123
           Q+A + C+   +++G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNGCRP
Sbjct: 65  QIAAERCAEIVKDYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRP 124

Query: 124 RKRRRI 129
            K+RR+
Sbjct: 125 PKKRRV 130


>gi|146297259|ref|YP_001181030.1| 30S ribosomal protein S11 [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|222529704|ref|YP_002573586.1| 30S ribosomal protein S11 [Caldicellulosiruptor bescii DSM 6725]
 gi|302871524|ref|YP_003840160.1| 30S ribosomal protein S11 [Caldicellulosiruptor obsidiansis OB47]
 gi|312127252|ref|YP_003992126.1| 30S ribosomal protein s11 [Caldicellulosiruptor hydrothermalis 108]
 gi|312135470|ref|YP_004002808.1| 30S ribosomal protein s11 [Caldicellulosiruptor owensensis OL]
 gi|312622071|ref|YP_004023684.1| 30S ribosomal protein s11 [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312793913|ref|YP_004026836.1| 30S ribosomal protein s11 [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312877391|ref|ZP_07737356.1| 30S ribosomal protein S11 [Caldicellulosiruptor lactoaceticus 6A]
 gi|172046029|sp|A4XLQ4|RS11_CALS8 RecName: Full=30S ribosomal protein S11
 gi|254765361|sp|B9MKF5|RS11_ANATD RecName: Full=30S ribosomal protein S11
 gi|145410835|gb|ABP67839.1| SSU ribosomal protein S11P [Caldicellulosiruptor saccharolyticus
           DSM 8903]
 gi|222456551|gb|ACM60813.1| ribosomal protein S11 [Caldicellulosiruptor bescii DSM 6725]
 gi|302574383|gb|ADL42174.1| 30S ribosomal protein S11 [Caldicellulosiruptor obsidiansis OB47]
 gi|311775521|gb|ADQ05008.1| 30S ribosomal protein S11 [Caldicellulosiruptor owensensis OL]
 gi|311777271|gb|ADQ06757.1| 30S ribosomal protein S11 [Caldicellulosiruptor hydrothermalis 108]
 gi|311795865|gb|EFR12229.1| 30S ribosomal protein S11 [Caldicellulosiruptor lactoaceticus 6A]
 gi|312181053|gb|ADQ41223.1| 30S ribosomal protein S11 [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312202538|gb|ADQ45865.1| 30S ribosomal protein S11 [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 130

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 69/122 (56%), Positives = 89/122 (72%)

Query: 8   IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
           +R  ERKN+  G AH+ STFNNT +TITDP GN IAW+S    GFSG++K +PFAAQ+A 
Sbjct: 9   VRRSERKNVEKGIAHIHSTFNNTIVTITDPSGNAIAWASAGTCGFSGTKKGTPFAAQLAA 68

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
           +  +  A +HGM ++EV V G GAGR++A+RAL+A G  +  I DVT I HNGCRP KRR
Sbjct: 69  EKAAKMAMDHGMRTVEVYVKGPGAGREAAIRALQAAGLEVTLIKDVTPIPHNGCRPPKRR 128

Query: 128 RI 129
           R+
Sbjct: 129 RV 130


>gi|196228478|ref|ZP_03127345.1| ribosomal protein S11 [Chthoniobacter flavus Ellin428]
 gi|196227881|gb|EDY22384.1| ribosomal protein S11 [Chthoniobacter flavus Ellin428]
          Length = 196

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 88/122 (72%)

Query: 8   IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
           I+ +  KN+ SG AH+V++FNNT +TITD +G+TI WSS    GF GSRK++ +AAQ+  
Sbjct: 75  IKAKGSKNVHSGIAHIVASFNNTIVTITDMNGSTIGWSSAGKCGFKGSRKSTAYAAQMVA 134

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
            D   +A  HG+  +EV+V G GAGR+SA+RA++A+G  I  I DVT + HNGCRP K+R
Sbjct: 135 QDACRQAMGHGLKEVEVRVKGPGAGRESAVRAIQAVGLEISIIKDVTPVPHNGCRPPKQR 194

Query: 128 RI 129
           R+
Sbjct: 195 RV 196


>gi|54022802|ref|YP_117044.1| 30S ribosomal protein S11 [Nocardia farcinica IFM 10152]
 gi|59798618|sp|Q5Z1L1|RS11_NOCFA RecName: Full=30S ribosomal protein S11
 gi|54014310|dbj|BAD55680.1| putative ribosomal protein S11 [Nocardia farcinica IFM 10152]
          Length = 137

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 95/128 (74%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK   + R R++KN+  G AH+ STFNNT ++ITDP+GN I+W+S   VGF GSRK++PF
Sbjct: 10  PKKTQKSRRRDKKNVPHGNAHIKSTFNNTIVSITDPNGNVISWASSGHVGFKGSRKSTPF 69

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ+A ++ + KAQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGC
Sbjct: 70  AAQLAAENAARKAQEHGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGTISDVTPQPHNGC 129

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 130 RPPKRRRV 137


>gi|225387212|ref|ZP_03756976.1| hypothetical protein CLOSTASPAR_00964 [Clostridium asparagiforme
           DSM 15981]
 gi|225046691|gb|EEG56937.1| hypothetical protein CLOSTASPAR_00964 [Clostridium asparagiforme
           DSM 15981]
          Length = 123

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 59/121 (48%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KN+  G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GSRK++P+AAQ+A +
Sbjct: 3   KKRVKKNVERGQAHIQSSFNNTIVTLTDAQGNALSWASAGGLGFRGSRKSTPYAAQMAAE 62

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ +++V V G G+GR++A+RAL+A G  + SI DVT + HNGCRP KRRR
Sbjct: 63  TATKAALVHGLKTVDVMVKGPGSGREAAIRALQACGLEVTSIKDVTPVPHNGCRPPKRRR 122

Query: 129 I 129
           +
Sbjct: 123 V 123


>gi|257440242|ref|ZP_05615997.1| 30S ribosomal protein S11 [Faecalibacterium prausnitzii A2-165]
 gi|313112852|ref|ZP_07798498.1| 30S ribosomal protein S11 [Faecalibacterium cf. prausnitzii
           KLE1255]
 gi|257197276|gb|EEU95560.1| 30S ribosomal protein S11 [Faecalibacterium prausnitzii A2-165]
 gi|295101437|emb|CBK98982.1| SSU ribosomal protein S11P [Faecalibacterium prausnitzii L2-6]
 gi|310624757|gb|EFQ08066.1| 30S ribosomal protein S11 [Faecalibacterium cf. prausnitzii
           KLE1255]
          Length = 136

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 89/123 (72%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R++ +ERKNI +G+AH+ STFNNT +TITD  GN ++W S   + F GSRK++PFAAQ A
Sbjct: 14  RMKRKERKNIAAGQAHIQSTFNNTVVTITDLQGNAVSWCSSGSLNFRGSRKSTPFAAQSA 73

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  +  A  HGM ++EV V G GAGR+SA+RAL+A G  +  I DVT I HNGCRP KR
Sbjct: 74  AETAAKVAIEHGMKTVEVYVKGPGAGRESAIRALQATGLEVTLIKDVTPIPHNGCRPPKR 133

Query: 127 RRI 129
           RR+
Sbjct: 134 RRV 136


>gi|284033973|ref|YP_003383904.1| 30S ribosomal protein S11 [Kribbella flavida DSM 17836]
 gi|283813266|gb|ADB35105.1| ribosomal protein S11 [Kribbella flavida DSM 17836]
          Length = 135

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 91/123 (73%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +E+KN+ +G AH+ STFNNT +TITDP G  I+W+S   VGF GSRK++PFAAQ+A
Sbjct: 13  KVRRKEKKNVAAGHAHIKSTFNNTIVTITDPTGAVISWASAGTVGFKGSRKSTPFAAQMA 72

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +    +A  HGM  ++V V G G+GR++A+R+L A+G  + +I DVT  AHNGCRP KR
Sbjct: 73  AEAAGRRAMEHGMRKIDVFVKGPGSGRETAIRSLGAVGLEVGTIQDVTPTAHNGCRPPKR 132

Query: 127 RRI 129
           RR+
Sbjct: 133 RRV 135


>gi|307128727|ref|YP_003880757.1| 30S ribosomal protein S11 [Candidatus Sulcia muelleri CARI]
 gi|306483189|gb|ADM90059.1| 30S ribosomal protein S11 [Candidatus Sulcia muelleri CARI]
          Length = 120

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 83/118 (70%)

Query: 12  ERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCS 71
           ++KN V G  H+ STFNN  IT+T+  G+ IAWSS   +GF GS+KN+P+AAQVA +D +
Sbjct: 3   KKKNSVIGEVHIKSTFNNIIITLTNKKGDVIAWSSAGKMGFKGSKKNTPYAAQVAAEDVA 62

Query: 72  AKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            K  N G+  LEV + G GAGRD+A+RAL    F I+ I D+T I HNGCRP K+RRI
Sbjct: 63  EKGLNAGIKKLEVIIKGPGAGRDAAIRALVNKNFNILVIKDITPIPHNGCRPPKKRRI 120


>gi|307266988|ref|ZP_07548504.1| 30S ribosomal protein S11 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|326390635|ref|ZP_08212190.1| 30S ribosomal protein S11 [Thermoanaerobacter ethanolicus JW 200]
 gi|306917973|gb|EFN48231.1| 30S ribosomal protein S11 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|325993313|gb|EGD51750.1| 30S ribosomal protein S11 [Thermoanaerobacter ethanolicus JW 200]
          Length = 130

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 91/121 (75%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R RE+K++  G AH+ STFNNT +TITDP GNTI+W+S   +GF GSRK++PFAAQ+A +
Sbjct: 10  RKREKKHVERGIAHIHSTFNNTIVTITDPAGNTISWASAGTIGFKGSRKSTPFAAQMAAE 69

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A +HGM +++V V G GAGR++A+RAL+A G  +  I DVT I HNGCRP KRRR
Sbjct: 70  SAAKAAMDHGMKTVDVYVKGPGAGREAAIRALQAAGLEVSLIKDVTPIPHNGCRPPKRRR 129

Query: 129 I 129
           +
Sbjct: 130 V 130


>gi|163847948|ref|YP_001635992.1| 30S ribosomal protein S11 [Chloroflexus aurantiacus J-10-fl]
 gi|222525828|ref|YP_002570299.1| 30S ribosomal protein S11 [Chloroflexus sp. Y-400-fl]
 gi|163669237|gb|ABY35603.1| ribosomal protein S11 [Chloroflexus aurantiacus J-10-fl]
 gi|222449707|gb|ACM53973.1| ribosomal protein S11 [Chloroflexus sp. Y-400-fl]
          Length = 136

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 69/124 (55%), Positives = 91/124 (73%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
            R + RERKN+  G+AH+ STFNNT +TITDP G  + W+S    GF GSRK++P+AAQV
Sbjct: 13  QRGKRRERKNVPRGQAHIQSTFNNTIVTITDPQGAVVCWASAGQSGFKGSRKSTPYAAQV 72

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A ++ + KA  +GM S+EV V G GAGR++A+R+L+A G  I +I DVT I HNGCRP K
Sbjct: 73  AAENAARKAMENGMRSVEVFVKGPGAGREAAIRSLQAAGLQITAITDVTPIPHNGCRPPK 132

Query: 126 RRRI 129
           RRR+
Sbjct: 133 RRRV 136


>gi|288942049|ref|YP_003444289.1| 30S ribosomal protein S11 [Allochromatium vinosum DSM 180]
 gi|288897421|gb|ADC63257.1| 30S ribosomal protein S11 [Allochromatium vinosum DSM 180]
          Length = 129

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 86/129 (66%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K     + + +K +  G AHV ++FNNT ITITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKPIRNTKKKIKKQVADGVAHVHASFNNTIITITDRQGNALAWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA D     A+ +G+ +L+V V G G GR+SA+RAL   GF I SI DVT I HNG
Sbjct: 61  FAAQVAADKAGQAAKEYGLRNLDVNVKGPGPGRESAVRALNNAGFKITSITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|148655312|ref|YP_001275517.1| 30S ribosomal protein S11 [Roseiflexus sp. RS-1]
 gi|166231831|sp|A5USG4|RS11_ROSS1 RecName: Full=30S ribosomal protein S11
 gi|148567422|gb|ABQ89567.1| SSU ribosomal protein S11P [Roseiflexus sp. RS-1]
          Length = 139

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 69/124 (55%), Positives = 91/124 (73%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
            R + RE+KN+  G+AH+ STFNNT +TITDP GN I WSS    GF GSRK++P+AAQV
Sbjct: 16  QRGKRREKKNVPRGQAHIQSTFNNTIVTITDPAGNVICWSSAGQNGFKGSRKSTPYAAQV 75

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A ++ + KA  +GM  +EV V G GAGR++A+R+L+A G  + +I DVT I HNGCRP K
Sbjct: 76  AAENAARKAMENGMRQVEVFVKGPGAGREAAIRSLQAAGLQVTAITDVTPIPHNGCRPPK 135

Query: 126 RRRI 129
           RRR+
Sbjct: 136 RRRV 139


>gi|223983945|ref|ZP_03634105.1| hypothetical protein HOLDEFILI_01386 [Holdemania filiformis DSM
           12042]
 gi|223964137|gb|EEF68489.1| hypothetical protein HOLDEFILI_01386 [Holdemania filiformis DSM
           12042]
          Length = 130

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 70/126 (55%), Positives = 85/126 (67%), Gaps = 1/126 (0%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K  SR R R RKN+  G AH+ STFNNT +TITD  GN IAWSS   +GF GSRK++PFA
Sbjct: 5   KQTSRKR-RVRKNVARGVAHIHSTFNNTIVTITDESGNAIAWSSAGALGFKGSRKSTPFA 63

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +     A +HGM  +EV V G G GR++A+R+L+  G  I  I DVT I HNGCR
Sbjct: 64  AQMAGEAAGKAAVDHGMKVVEVNVKGPGPGREAAVRSLQTAGLEITVINDVTPIPHNGCR 123

Query: 123 PRKRRR 128
           P KR R
Sbjct: 124 PPKRPR 129


>gi|313836058|gb|EFS73772.1| 30S ribosomal protein S11 [Propionibacterium acnes HL037PA2]
 gi|314929594|gb|EFS93425.1| 30S ribosomal protein S11 [Propionibacterium acnes HL044PA1]
 gi|314970519|gb|EFT14617.1| 30S ribosomal protein S11 [Propionibacterium acnes HL037PA3]
 gi|328906197|gb|EGG25972.1| 30S ribosomal protein S11 [Propionibacterium sp. P08]
          Length = 135

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 91/124 (73%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +++R +E+KN+ +G+AH+ STFNNT I ITDP G  I+W+S   VGF GSRK++PFAAQ+
Sbjct: 12  AKVRRKEKKNVAAGQAHIKSTFNNTIIAITDPSGAVISWASAGTVGFKGSRKSTPFAAQM 71

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +    +A  HGM  ++V V G G+GR++A+R+L A+G  I  I DVT + HNGCRP K
Sbjct: 72  AAEAAGRRAMEHGMKRVDVFVKGPGSGRETAIRSLGAVGLEIGPISDVTPVPHNGCRPPK 131

Query: 126 RRRI 129
           RRR+
Sbjct: 132 RRRV 135


>gi|28867877|ref|NP_790496.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|66047753|ref|YP_237594.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. syringae B728a]
 gi|71735671|ref|YP_276683.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|77461278|ref|YP_350785.1| 30S ribosomal protein S11 [Pseudomonas fluorescens Pf0-1]
 gi|213969237|ref|ZP_03397375.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. tomato T1]
 gi|229592880|ref|YP_002874999.1| 30S ribosomal protein S11 [Pseudomonas fluorescens SBW25]
 gi|237797455|ref|ZP_04585916.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|257483208|ref|ZP_05637249.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289623826|ref|ZP_06456780.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289648919|ref|ZP_06480262.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|289675511|ref|ZP_06496401.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. syringae FF5]
 gi|298489073|ref|ZP_07007095.1| SSU ribosomal protein S11p (S14e) [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|301381744|ref|ZP_07230162.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. tomato Max13]
 gi|302061056|ref|ZP_07252597.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. tomato K40]
 gi|302130803|ref|ZP_07256793.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|302189300|ref|ZP_07265973.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. syringae 642]
 gi|330812053|ref|YP_004356515.1| 30S ribosomal protein S11 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|32171597|sp|Q889U8|RS11_PSESM RecName: Full=30S ribosomal protein S11
 gi|75500422|sp|Q4ZMR6|RS11_PSEU2 RecName: Full=30S ribosomal protein S11
 gi|91207669|sp|Q48D59|RS11_PSE14 RecName: Full=30S ribosomal protein S11
 gi|91207672|sp|Q3K610|RS11_PSEPF RecName: Full=30S ribosomal protein S11
 gi|259494631|sp|C3K2V3|RS11_PSEFS RecName: Full=30S ribosomal protein S11
 gi|28851113|gb|AAO54191.1| ribosomal protein S11 [Pseudomonas syringae pv. tomato str. DC3000]
 gi|63258460|gb|AAY39556.1| Ribosomal protein S11 [Pseudomonas syringae pv. syringae B728a]
 gi|71556224|gb|AAZ35435.1| ribosomal protein S11 [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|77385281|gb|ABA76794.1| 30S ribosomal protein S11 [Pseudomonas fluorescens Pf0-1]
 gi|213925915|gb|EEB59472.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. tomato T1]
 gi|229364746|emb|CAY52727.1| 30S ribosomal protein S11 [Pseudomonas fluorescens SBW25]
 gi|298156385|gb|EFH97483.1| SSU ribosomal protein S11p (S14e) [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|310941663|dbj|BAJ24185.1| 30S ribosomal protein S11 [Pseudomonas fluorescens]
 gi|310941753|dbj|BAJ24230.1| 30S ribosomal protein S11 [Pseudomonas azotoformans]
 gi|310941933|dbj|BAJ24320.1| 30S ribosomal protein S11 [Pseudomonas putida]
 gi|310941963|dbj|BAJ24335.1| 30S ribosomal protein S11 [Pseudomonas fluorescens]
 gi|320322299|gb|EFW78393.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320331957|gb|EFW87893.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|327380161|gb|AEA71511.1| 30S ribosomal protein S11 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|330869408|gb|EGH04117.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330879398|gb|EGH13547.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330879419|gb|EGH13568.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|330899713|gb|EGH31132.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330940913|gb|EGH43864.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. pisi str.
           1704B]
 gi|330962502|gb|EGH62762.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. maculicola str.
           ES4326]
 gi|330966888|gb|EGH67148.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. actinidiae str.
           M302091]
 gi|330969798|gb|EGH69864.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. aceris str.
           M302273PT]
 gi|330976663|gb|EGH76706.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. aptata str. DSM
           50252]
 gi|330988259|gb|EGH86362.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331012436|gb|EGH92492.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331018183|gb|EGH98239.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
 gi|331020305|gb|EGI00362.1| 30S ribosomal protein S11 [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 129

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/129 (49%), Positives = 88/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R R + +K +V G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKPAARPRKKVKKTVVDGIAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     A  +G+ +L+V V G G GR+SA+RAL   G+ I SI DVT I HNG
Sbjct: 61  FAAQVAAERAGQAALEYGLKNLDVNVKGPGPGRESAVRALNGCGYKIASITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|219849862|ref|YP_002464295.1| 30S ribosomal protein S11 [Chloroflexus aggregans DSM 9485]
 gi|219544121|gb|ACL25859.1| ribosomal protein S11 [Chloroflexus aggregans DSM 9485]
          Length = 137

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 90/124 (72%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
            R + RERKN+  G AH+ STFNNT +TITDP G  + WSS    GF GSRK++P+AAQV
Sbjct: 14  QRGKRRERKNVPRGYAHIQSTFNNTIVTITDPQGAVVCWSSAGQSGFKGSRKSTPYAAQV 73

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A ++ + KA  +GM S+EV V G GAGR++A+R+L+A G  I +I DVT I HNGCRP K
Sbjct: 74  AAENAARKAMENGMRSVEVFVKGPGAGREAAIRSLQAAGLQITAITDVTPIPHNGCRPPK 133

Query: 126 RRRI 129
           RRR+
Sbjct: 134 RRRV 137


>gi|149912287|ref|ZP_01900858.1| 30S ribosomal protein S11 [Moritella sp. PE36]
 gi|149804632|gb|EDM64691.1| 30S ribosomal protein S11 [Moritella sp. PE36]
          Length = 120

 Score =  132 bits (332), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/119 (52%), Positives = 85/119 (71%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           R +K +  G AHV ++FNNT +TITD  GN ++W++    GF GSRK++PFAAQVA +  
Sbjct: 2   RVKKQVADGIAHVHASFNNTIVTITDRQGNALSWATAGGSGFRGSRKSTPFAAQVAAERA 61

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
              A+ +G+ +LEV V G G GR+S++RAL AIGF I +I DVT I HNGCRP K+RR+
Sbjct: 62  GEMAKEYGLKNLEVMVKGPGPGRESSIRALNAIGFKITNITDVTPIPHNGCRPPKKRRV 120


>gi|257792536|ref|YP_003183142.1| 30S ribosomal protein S11 [Eggerthella lenta DSM 2243]
 gi|317490402|ref|ZP_07948886.1| 30S ribosomal protein S11 [Eggerthella sp. 1_3_56FAA]
 gi|325833481|ref|ZP_08165930.1| 30S ribosomal protein S11 [Eggerthella sp. HGA1]
 gi|257476433|gb|ACV56753.1| ribosomal protein S11 [Eggerthella lenta DSM 2243]
 gi|316910537|gb|EFV32162.1| 30S ribosomal protein S11 [Eggerthella sp. 1_3_56FAA]
 gi|325485405|gb|EGC87874.1| 30S ribosomal protein S11 [Eggerthella sp. HGA1]
          Length = 132

 Score =  132 bits (332), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 69/124 (55%), Positives = 89/124 (71%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +RI+  ERKNI  G AH+ STFNNT ++ITDP GN I+W S   VGF GSRK++PFAAQ+
Sbjct: 9   TRIKRSERKNIAVGAAHIKSTFNNTIVSITDPQGNVISWQSAGTVGFKGSRKSTPFAAQM 68

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  +  A  HG+  + V V G G+GR++A+R+L+A G  I SI D T I HNGCRPRK
Sbjct: 69  AAEAAAKTAMEHGLRKVSVFVKGPGSGRETAIRSLQAAGLEIASIQDCTPIPHNGCRPRK 128

Query: 126 RRRI 129
           RRR+
Sbjct: 129 RRRV 132


>gi|294669847|ref|ZP_06734906.1| hypothetical protein NEIELOOT_01740 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308240|gb|EFE49483.1| hypothetical protein NEIELOOT_01740 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 145

 Score =  132 bits (332), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/119 (52%), Positives = 84/119 (70%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R+R + RK I  G  HV ++FNNT ITITD  GN ++W++    GF GSRK++PFAAQVA
Sbjct: 9   RVRKKVRKTISEGIVHVHASFNNTIITITDRQGNALSWATSGGAGFKGSRKSTPFAAQVA 68

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
            +     AQ +G+ +LEV++ G G GR+S++RAL A+GF I SI DVT + HNGCRP K
Sbjct: 69  AETAGKVAQEYGIKNLEVRIKGPGPGRESSVRALNALGFKITSITDVTPLPHNGCRPPK 127


>gi|148273769|ref|YP_001223330.1| 30S ribosomal protein S11 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|170780765|ref|YP_001709097.1| 30S ribosomal protein S11 [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|172047232|sp|A5CU81|RS11_CLAM3 RecName: Full=30S ribosomal protein S11
 gi|189040407|sp|B0RB71|RS11_CLAMS RecName: Full=30S ribosomal protein S11
 gi|147831699|emb|CAN02668.1| 30S ribosomal protein S11 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|169155333|emb|CAQ00436.1| 30S ribosomal protein S11 [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 132

 Score =  132 bits (332), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 97/129 (75%), Gaps = 1/129 (0%)

Query: 2   PKSPSR-IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           PKS  R  R +++KNI  G+AH+ STFNNT ++ITDP G  I+W+S  VVG++GSRK++P
Sbjct: 4   PKSAVRKPRRKDKKNIAVGQAHIKSTFNNTIVSITDPTGAVISWASSGVVGYNGSRKSTP 63

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  + +AQ HGM  ++V V G G+GR++A+R+L+A G  + SI DVT  AHNG
Sbjct: 64  FAAQLAAESAARQAQEHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVGSINDVTPQAHNG 123

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 124 CRPPKRRRV 132


>gi|167749412|ref|ZP_02421539.1| hypothetical protein EUBSIR_00366 [Eubacterium siraeum DSM 15702]
 gi|167657584|gb|EDS01714.1| hypothetical protein EUBSIR_00366 [Eubacterium siraeum DSM 15702]
 gi|291532116|emb|CBK97701.1| SSU ribosomal protein S11P [Eubacterium siraeum 70/3]
 gi|291558144|emb|CBL35261.1| SSU ribosomal protein S11P [Eubacterium siraeum V10Sc8a]
          Length = 134

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 91/127 (71%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K P   R RERKNI +G AH+ STFNNT +TITD  GNT++W+S   +GF GSRK++PFA
Sbjct: 8   KKPVVRRRRERKNIENGSAHIQSTFNNTIVTITDLQGNTLSWASAGEMGFRGSRKSTPFA 67

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ A +  +  A  HG+ ++EV V G G+GR++A+RAL+A G  +  I DVT I HNGCR
Sbjct: 68  AQTAAETAAKAAMEHGLKTVEVYVKGPGSGREAAIRALQAAGLEVRLIKDVTPIPHNGCR 127

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 128 PPKRRRV 134


>gi|70732861|ref|YP_262628.1| 30S ribosomal protein S11 [Pseudomonas fluorescens Pf-5]
 gi|91207670|sp|Q4K555|RS11_PSEF5 RecName: Full=30S ribosomal protein S11
 gi|68347160|gb|AAY94766.1| ribosomal protein S11 [Pseudomonas fluorescens Pf-5]
 gi|310941783|dbj|BAJ24245.1| 30S ribosomal protein S11 [Pseudomonas chlororaphis subsp.
           chlororaphis]
          Length = 129

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 64/129 (49%), Positives = 88/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R R + +K +V G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKPAARPRKKIKKTVVDGIAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     A  +G+ +L+V V G G GR+SA+RAL   G+ I SI DVT I HNG
Sbjct: 61  FAAQVAAERAGQAALEYGLKNLDVNVKGPGPGRESAVRALNGCGYKIASITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|26987218|ref|NP_742643.1| 30S ribosomal protein S11 [Pseudomonas putida KT2440]
 gi|104779778|ref|YP_606276.1| 30S ribosomal protein S11 [Pseudomonas entomophila L48]
 gi|148545762|ref|YP_001265864.1| 30S ribosomal protein S11 [Pseudomonas putida F1]
 gi|170723883|ref|YP_001751571.1| 30S ribosomal protein S11 [Pseudomonas putida W619]
 gi|325272031|ref|ZP_08138474.1| 30S ribosomal protein S11 [Pseudomonas sp. TJI-51]
 gi|29337188|sp|P59374|RS11_PSEPK RecName: Full=30S ribosomal protein S11
 gi|123079275|sp|Q1IFU3|RS11_PSEE4 RecName: Full=30S ribosomal protein S11
 gi|166231825|sp|A5VXS0|RS11_PSEP1 RecName: Full=30S ribosomal protein S11
 gi|226708404|sp|B1JAI9|RS11_PSEPW RecName: Full=30S ribosomal protein S11
 gi|24981857|gb|AAN66107.1|AE016239_2 ribosomal protein S11 [Pseudomonas putida KT2440]
 gi|95108765|emb|CAK13459.1| 30S ribosomal protein S11 [Pseudomonas entomophila L48]
 gi|148509820|gb|ABQ76680.1| SSU ribosomal protein S11P [Pseudomonas putida F1]
 gi|169761886|gb|ACA75202.1| ribosomal protein S11 [Pseudomonas putida W619]
 gi|310940982|dbj|BAJ24365.1| 30S ribosomal protein S11 [Pseudomonas putida]
 gi|310941012|dbj|BAJ24380.1| 30S ribosomal protein S11 [Pseudomonas putida]
 gi|310941042|dbj|BAJ24395.1| 30S ribosomal protein S11 [Pseudomonas putida]
 gi|310941072|dbj|BAJ24410.1| 30S ribosomal protein S11 [Pseudomonas putida]
 gi|310941102|dbj|BAJ24425.1| 30S ribosomal protein S11 [Pseudomonas putida]
 gi|310941633|dbj|BAJ24170.1| 30S ribosomal protein S11 [Pseudomonas putida]
 gi|310941813|dbj|BAJ24260.1| 30S ribosomal protein S11 [Pseudomonas fulva]
 gi|310941993|dbj|BAJ24350.1| 30S ribosomal protein S11 [Pseudomonas putida]
 gi|313496842|gb|ADR58208.1| 30S ribosomal protein S11 [Pseudomonas putida BIRD-1]
 gi|324102835|gb|EGC00239.1| 30S ribosomal protein S11 [Pseudomonas sp. TJI-51]
          Length = 129

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 63/129 (48%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R R + +K +V G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKPAARPRKKVKKTVVDGIAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +     A  +G+ +L+V V G G GR+SA+RAL + G+ I SI DVT I HNG
Sbjct: 61  FAAQIAAERAGQAALEYGLKNLDVNVKGPGPGRESAVRALNSCGYKIASITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|291334080|gb|ADD93753.1| ribosomal protein S11 putative [uncultured marine bacterium
           MedDCM-OCT-S05-C114]
          Length = 185

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 83/116 (71%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           KNI +G   +V+TFNNT+++ +D  GN ++WSS     F GSRK++ +AAQV T D    
Sbjct: 70  KNISTGICFIVATFNNTKVSFSDMKGNVVSWSSSGKCNFRGSRKSTAYAAQVVTQDAGKV 129

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           A +HGM  + VKV G G GRDSA+RAL+++GFT+ +I DVT + HNGCRP KRRR+
Sbjct: 130 AMSHGMKEVVVKVKGPGMGRDSAIRALQSLGFTVSTIIDVTPVPHNGCRPPKRRRV 185


>gi|226365622|ref|YP_002783405.1| 30S ribosomal protein S11 [Rhodococcus opacus B4]
 gi|312140891|ref|YP_004008227.1| 30S ribosomal protein s11 rpsk [Rhodococcus equi 103S]
 gi|325675471|ref|ZP_08155155.1| 30S ribosomal protein S11 [Rhodococcus equi ATCC 33707]
 gi|254811039|sp|C1B039|RS11_RHOOB RecName: Full=30S ribosomal protein S11
 gi|226244112|dbj|BAH54460.1| 30S ribosomal protein S11 [Rhodococcus opacus B4]
 gi|311890230|emb|CBH49548.1| 30S ribosomal protein S11 RpsK [Rhodococcus equi 103S]
 gi|325553442|gb|EGD23120.1| 30S ribosomal protein S11 [Rhodococcus equi ATCC 33707]
          Length = 137

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 94/128 (73%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK   + R R++KN+  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++PF
Sbjct: 10  PKKTQKARRRDKKNVPHGAAHIKSTFNNTIVSITDPAGNVISWASSGHVGFKGSRKSTPF 69

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ+A ++ + KAQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGC
Sbjct: 70  AAQLAAENAARKAQEHGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGTISDVTPQPHNGC 129

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 130 RPPKRRRV 137


>gi|195952669|ref|YP_002120959.1| 30S ribosomal protein S11 [Hydrogenobaculum sp. Y04AAS1]
 gi|195932281|gb|ACG56981.1| ribosomal protein S11 [Hydrogenobaculum sp. Y04AAS1]
          Length = 130

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/130 (50%), Positives = 87/130 (66%), Gaps = 1/130 (0%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  ++   +E++N+ SG  H+ STFNNT IT+TD  GNT+AW S    GF G+RK +P
Sbjct: 1   MAKKRTKEAKKEKRNVSSGIVHIYSTFNNTIITVTDSLGNTLAWESGGTTGFKGTRKGTP 60

Query: 61  FAAQVATDDCSAKAQN-HGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           +AAQVA      KA N +G+   EV V G GAGR+SA+R+++A G  I +I DVT I HN
Sbjct: 61  YAAQVAAQKAIKKAVNEYGLQEAEVWVKGPGAGRESAIRSIQAAGVKIKAIRDVTPIPHN 120

Query: 120 GCRPRKRRRI 129
           GCRP  RRR+
Sbjct: 121 GCRPTSRRRV 130


>gi|111023123|ref|YP_706095.1| 30S ribosomal protein S11 [Rhodococcus jostii RHA1]
 gi|123339769|sp|Q0S3E9|RS11_RHOSR RecName: Full=30S ribosomal protein S11
 gi|110822653|gb|ABG97937.1| 30S ribosomal protein S11 [Rhodococcus jostii RHA1]
          Length = 137

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 94/128 (73%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK   + R R++KN+  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++PF
Sbjct: 10  PKKTQKARRRDKKNVPHGAAHIKSTFNNTIVSITDPAGNVISWASSGHVGFKGSRKSTPF 69

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ+A ++ + KAQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGC
Sbjct: 70  AAQLAAENAARKAQEHGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGTISDVTPQPHNGC 129

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 130 RPPKRRRV 137


>gi|269128487|ref|YP_003301857.1| 30S ribosomal protein S11 [Thermomonospora curvata DSM 43183]
 gi|268313445|gb|ACY99819.1| ribosomal protein S11 [Thermomonospora curvata DSM 43183]
          Length = 133

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/123 (53%), Positives = 91/123 (73%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +E+KNI  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++PFAAQ A
Sbjct: 11  KVRRKEKKNIAHGHAHIKSTFNNTIVSITDPQGNVISWASAGHVGFKGSRKSTPFAAQQA 70

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +A  HGM  ++V V G G+GR++A+R+L+A G  + SI DVT + HNGCRP KR
Sbjct: 71  AEAAARRAMEHGMRKVDVFVKGPGSGRETAIRSLQATGLEVGSIQDVTPVPHNGCRPPKR 130

Query: 127 RRI 129
           RR+
Sbjct: 131 RRV 133


>gi|312144222|ref|YP_003995668.1| 30S ribosomal protein S11 [Halanaerobium sp. 'sapolanicus']
 gi|311904873|gb|ADQ15314.1| 30S ribosomal protein S11 [Halanaerobium sp. 'sapolanicus']
          Length = 132

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 84/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI  G+AH+ STFNNT I+ITD  G  +AWSS   VG+ GSRK++PFAAQ+A ++ + +A
Sbjct: 18  NIEKGQAHIKSTFNNTIISITDTEGKVVAWSSAGKVGYKGSRKSTPFAAQLAAENVADEA 77

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           ++ G+  +E+ V G G+GR+SA+R L+A G  +  I D+T I HNGCRP KRRRI
Sbjct: 78  KDMGLKEIEIFVKGPGSGRESAIRTLQAAGLNVTLIKDITPIPHNGCRPPKRRRI 132


>gi|229823512|ref|ZP_04449581.1| hypothetical protein GCWU000282_00810 [Catonella morbi ATCC 51271]
 gi|229786956|gb|EEP23070.1| hypothetical protein GCWU000282_00810 [Catonella morbi ATCC 51271]
          Length = 131

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 86/115 (74%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G AH+ STFNNT + ITD +GN I+WSS   +GF GS+K++PFAAQ+A++  +  A
Sbjct: 17  NVEKGVAHIRSTFNNTIVMITDVNGNAISWSSAGSLGFRGSKKSTPFAAQMASEVAAKGA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            +HGM ++EV V G G+GR+SA+R+L+A G  + +I DVT I HNGCRP KRRR+
Sbjct: 77  MDHGMKTVEVTVKGPGSGRESAIRSLQATGLEVTAIRDVTPIPHNGCRPPKRRRV 131


>gi|152973982|ref|YP_001373499.1| 30S ribosomal protein S11 [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|189040401|sp|A7GK46|RS11_BACCN RecName: Full=30S ribosomal protein S11
 gi|152022734|gb|ABS20504.1| ribosomal protein S11 [Bacillus cytotoxicus NVH 391-98]
          Length = 129

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT +T+TD HGN I+WSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KKRVKKNIETGVAHIRSTFNNTIVTLTDTHGNAISWSSAGALGFRGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ SLEV V G GAGR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TAAKAAMEHGLKSLEVTVKGPGAGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|229083456|ref|ZP_04215804.1| 30S ribosomal protein S11 [Bacillus cereus Rock3-44]
 gi|228699889|gb|EEL52526.1| 30S ribosomal protein S11 [Bacillus cereus Rock3-44]
          Length = 129

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT +T+TD HGN ++WSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KKRVKKNIEAGVAHIRSTFNNTIVTLTDTHGNALSWSSAGALGFRGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ +LEV V G GAGR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TAAKVAMEHGLKTLEVTVKGPGAGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|238898904|ref|YP_002924586.1| 30S ribosomal subunit protein S11 [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
 gi|259494626|sp|C4K795|RS11_HAMD5 RecName: Full=30S ribosomal protein S11
 gi|229466664|gb|ACQ68438.1| 30S ribosomal subunit protein S11 [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
          Length = 129

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R   R ++ I +  AHV ++FNNT +TITD  GN +AW++    GF GSRK++P
Sbjct: 1   MAKAPIRAHKRIKRQIPNCIAHVHASFNNTIVTITDGQGNVLAWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   +++G+ +LEV V G G GR+S +RA  A G+ I SI D+T I HNG
Sbjct: 61  FAAQVAAERCAEAVKDYGIKTLEVIVKGPGPGRESTVRAFNASGYRITSITDMTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|119718097|ref|YP_925062.1| 30S ribosomal protein S11 [Nocardioides sp. JS614]
 gi|152060801|sp|A1SNJ0|RS11_NOCSJ RecName: Full=30S ribosomal protein S11
 gi|119538758|gb|ABL83375.1| SSU ribosomal protein S11P [Nocardioides sp. JS614]
          Length = 135

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 89/123 (72%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +E+KN+  G AH+ STFNNT +TITDP G  I+W+S   VGF GSRK++PFAAQ+A
Sbjct: 13  KVRRKEKKNVAMGEAHIKSTFNNTIVTITDPTGAVISWASAGTVGFKGSRKSTPFAAQMA 72

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +    +A  HGM  ++V V G G+GR++A+R+L AIG  + +I DVT   HNGCRP KR
Sbjct: 73  AEAAGRRAMEHGMKKIDVFVKGPGSGRETAIRSLGAIGLEVGTIQDVTPTPHNGCRPPKR 132

Query: 127 RRI 129
           RR+
Sbjct: 133 RRV 135


>gi|89893243|ref|YP_516730.1| 30S ribosomal protein S11 [Desulfitobacterium hafniense Y51]
 gi|219666516|ref|YP_002456951.1| 30S ribosomal protein S11 [Desulfitobacterium hafniense DCB-2]
 gi|123397896|sp|Q250K6|RS11_DESHY RecName: Full=30S ribosomal protein S11
 gi|254765381|sp|B8G1Z2|RS11_DESHD RecName: Full=30S ribosomal protein S11
 gi|89332691|dbj|BAE82286.1| 30S ribosomal protein S11 [Desulfitobacterium hafniense Y51]
 gi|219536776|gb|ACL18515.1| ribosomal protein S11 [Desulfitobacterium hafniense DCB-2]
          Length = 129

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 91/129 (70%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +   R + RERKNI +G AH+ STFNN+ +TITDP GN I+WSS   +GF GSRK++P
Sbjct: 1   MARKVVRTKRRERKNIATGVAHIKSTFNNSMVTITDPKGNVISWSSAGALGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +  +  A  HG+  +E  V G GAGR++A+RAL+A G  +  I DVT I HNG
Sbjct: 61  YAAQMAAETAAKAAMEHGLKEVECFVKGPGAGREAAIRALQAAGLEVNMIKDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|160947674|ref|ZP_02094841.1| hypothetical protein PEPMIC_01609 [Parvimonas micra ATCC 33270]
 gi|158446808|gb|EDP23803.1| hypothetical protein PEPMIC_01609 [Parvimonas micra ATCC 33270]
          Length = 131

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/127 (52%), Positives = 95/127 (74%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K  +R++ RERKNI  G+AH+VS+FNNT +T++D +GN I+W+S   +GF GSRK++PFA
Sbjct: 5   KQKARVKRRERKNIEKGQAHIVSSFNNTMVTLSDLNGNVISWASAGQLGFRGSRKSTPFA 64

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ A ++ + KA  HG+  +EV V G G+GR++A+R+L+A G  +  I DVT I HNGCR
Sbjct: 65  AQQAAEEAAKKAMEHGLKVVEVYVKGPGSGREAAIRSLQATGLEVSLIKDVTPIPHNGCR 124

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 125 PPKRRRV 131


>gi|317131396|ref|YP_004090710.1| 30S ribosomal protein S11 [Ethanoligenens harbinense YUAN-3]
 gi|315469375|gb|ADU25979.1| 30S ribosomal protein S11 [Ethanoligenens harbinense YUAN-3]
          Length = 137

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/121 (57%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + RERKNI  G AH+ STFNNT +TITD  GN+I+W+S   +GF GSRK+SPFAAQ+A +
Sbjct: 17  KRRERKNIDRGAAHIQSTFNNTIVTITDTQGNSISWASAGGLGFRGSRKSSPFAAQMAAE 76

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HGM ++EV V G GAGR++A+RAL+A G  +  I DVT I HNGCRP KRRR
Sbjct: 77  TAAKVAMEHGMKTIEVFVKGPGAGREAAIRALQAAGLEVNMIKDVTPIPHNGCRPPKRRR 136

Query: 129 I 129
           +
Sbjct: 137 V 137


>gi|294497010|ref|YP_003560710.1| 30S ribosomal protein S11 [Bacillus megaterium QM B1551]
 gi|295702375|ref|YP_003595450.1| 30S ribosomal protein S11 [Bacillus megaterium DSM 319]
 gi|294346947|gb|ADE67276.1| 30S ribosomal protein S11 [Bacillus megaterium QM B1551]
 gi|294800034|gb|ADF37100.1| 30S ribosomal protein S11 [Bacillus megaterium DSM 319]
          Length = 129

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 91/121 (75%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT +TITD HGN IAWSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVKKNIEAGVAHIRSTFNNTIVTITDVHGNAIAWSSAGALGFRGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  + ++GM +LEV V G GAGR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TAAKVSMDNGMKTLEVTVKGPGAGREAAIRALQAAGLEVTAIKDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|15900171|ref|NP_344775.1| 30S ribosomal protein S11 [Streptococcus pneumoniae TIGR4]
 gi|15902258|ref|NP_357808.1| 30S ribosomal protein S11 [Streptococcus pneumoniae R6]
 gi|111658777|ref|ZP_01409408.1| hypothetical protein SpneT_02000074 [Streptococcus pneumoniae
           TIGR4]
 gi|116515441|ref|YP_815736.1| 30S ribosomal protein S11 [Streptococcus pneumoniae D39]
 gi|125717011|ref|YP_001034144.1| 30S ribosomal protein S11 [Streptococcus sanguinis SK36]
 gi|148983634|ref|ZP_01816953.1| 30S ribosomal protein S13 [Streptococcus pneumoniae SP3-BS71]
 gi|148987972|ref|ZP_01819435.1| 30S ribosomal protein S13 [Streptococcus pneumoniae SP6-BS73]
 gi|148992812|ref|ZP_01822455.1| 30S ribosomal protein S13 [Streptococcus pneumoniae SP9-BS68]
 gi|148996657|ref|ZP_01824375.1| 30S ribosomal protein S13 [Streptococcus pneumoniae SP11-BS70]
 gi|149001658|ref|ZP_01826631.1| DNA-directed RNA polymerase subunit alpha [Streptococcus pneumoniae
           SP14-BS69]
 gi|149005986|ref|ZP_01829715.1| 30S ribosomal protein S13 [Streptococcus pneumoniae SP18-BS74]
 gi|149011105|ref|ZP_01832410.1| 30S ribosomal protein S13 [Streptococcus pneumoniae SP19-BS75]
 gi|149017925|ref|ZP_01834384.1| 30S ribosomal protein S13 [Streptococcus pneumoniae SP23-BS72]
 gi|157150189|ref|YP_001451210.1| 30S ribosomal protein S11 [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|168483872|ref|ZP_02708824.1| ribosomal protein S11 [Streptococcus pneumoniae CDC1873-00]
 gi|168485998|ref|ZP_02710506.1| ribosomal protein S11 [Streptococcus pneumoniae CDC1087-00]
 gi|168489712|ref|ZP_02713911.1| ribosomal protein S11 [Streptococcus pneumoniae SP195]
 gi|168492189|ref|ZP_02716332.1| ribosomal protein S11 [Streptococcus pneumoniae CDC0288-04]
 gi|168493929|ref|ZP_02718072.1| ribosomal protein S11 [Streptococcus pneumoniae CDC3059-06]
 gi|168576338|ref|ZP_02722221.1| ribosomal protein S11 [Streptococcus pneumoniae MLV-016]
 gi|169832451|ref|YP_001693766.1| 30S ribosomal protein S11 [Streptococcus pneumoniae Hungary19A-6]
 gi|182683212|ref|YP_001834959.1| 30S ribosomal protein S11 [Streptococcus pneumoniae CGSP14]
 gi|194398129|ref|YP_002036934.1| 30S ribosomal protein S11 [Streptococcus pneumoniae G54]
 gi|221231137|ref|YP_002510289.1| 30S ribosomal protein S11 [Streptococcus pneumoniae ATCC 700669]
 gi|225853840|ref|YP_002735352.1| 30S ribosomal protein S11 [Streptococcus pneumoniae JJA]
 gi|225855999|ref|YP_002737510.1| 30S ribosomal protein S11 [Streptococcus pneumoniae P1031]
 gi|225858088|ref|YP_002739598.1| 30S ribosomal protein S11 [Streptococcus pneumoniae 70585]
 gi|225860276|ref|YP_002741785.1| 30S ribosomal protein S11 [Streptococcus pneumoniae Taiwan19F-14]
 gi|237649698|ref|ZP_04523950.1| 30S ribosomal protein S11 [Streptococcus pneumoniae CCRI 1974]
 gi|237821396|ref|ZP_04597241.1| 30S ribosomal protein S11 [Streptococcus pneumoniae CCRI 1974M2]
 gi|262283557|ref|ZP_06061322.1| ribosomal protein S11 [Streptococcus sp. 2_1_36FAA]
 gi|270292025|ref|ZP_06198240.1| ribosomal protein S11 [Streptococcus sp. M143]
 gi|289168707|ref|YP_003446976.1| 30S ribosomal protein S11 [Streptococcus mitis B6]
 gi|298230391|ref|ZP_06964072.1| 30S ribosomal protein S11 [Streptococcus pneumoniae str. Canada
           MDR_19F]
 gi|298256012|ref|ZP_06979598.1| 30S ribosomal protein S11 [Streptococcus pneumoniae str. Canada
           MDR_19A]
 gi|303255070|ref|ZP_07341146.1| 30S ribosomal protein S11 [Streptococcus pneumoniae BS455]
 gi|303259286|ref|ZP_07345264.1| 30S ribosomal protein S11 [Streptococcus pneumoniae SP-BS293]
 gi|303261041|ref|ZP_07346990.1| 30S ribosomal protein S11 [Streptococcus pneumoniae SP14-BS292]
 gi|303263369|ref|ZP_07349292.1| 30S ribosomal protein S11 [Streptococcus pneumoniae BS397]
 gi|303265534|ref|ZP_07351434.1| 30S ribosomal protein S11 [Streptococcus pneumoniae BS457]
 gi|303267908|ref|ZP_07353710.1| 30S ribosomal protein S11 [Streptococcus pneumoniae BS458]
 gi|306825962|ref|ZP_07459298.1| 30S ribosomal protein S11 [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|306828807|ref|ZP_07461999.1| 30S ribosomal protein S11 [Streptococcus mitis ATCC 6249]
 gi|307066912|ref|YP_003875878.1| hypothetical protein SPAP_0283 [Streptococcus pneumoniae AP200]
 gi|307126453|ref|YP_003878484.1| 30S ribosomal protein S11 [Streptococcus pneumoniae 670-6B]
 gi|307702710|ref|ZP_07639662.1| 30S ribosomal protein S11 [Streptococcus oralis ATCC 35037]
 gi|307704089|ref|ZP_07641018.1| 30S ribosomal protein S11 [Streptococcus mitis SK597]
 gi|307708084|ref|ZP_07644552.1| ribosomal protein S11 [Streptococcus mitis NCTC 12261]
 gi|307709935|ref|ZP_07646382.1| 30S ribosomal protein S11 [Streptococcus mitis SK564]
 gi|307711031|ref|ZP_07647453.1| 30S ribosomal protein S11 [Streptococcus mitis SK321]
 gi|309799083|ref|ZP_07693336.1| ribosomal protein S11 [Streptococcus infantis SK1302]
 gi|315222794|ref|ZP_07864680.1| 30S ribosomal protein S11 [Streptococcus anginosus F0211]
 gi|315612356|ref|ZP_07887269.1| 30S ribosomal protein S11 [Streptococcus sanguinis ATCC 49296]
 gi|319940036|ref|ZP_08014390.1| 30S ribosomal protein S11 [Streptococcus anginosus 1_2_62CV]
 gi|319945811|ref|ZP_08020061.1| 30S ribosomal protein S11 [Streptococcus australis ATCC 700641]
 gi|322375015|ref|ZP_08049529.1| 30S ribosomal protein S11 [Streptococcus sp. C300]
 gi|322377206|ref|ZP_08051698.1| 30S ribosomal protein S11 [Streptococcus sp. M334]
 gi|322386329|ref|ZP_08059959.1| 30S ribosomal protein S11 [Streptococcus cristatus ATCC 51100]
 gi|322388377|ref|ZP_08061980.1| 30S ribosomal protein S11 [Streptococcus infantis ATCC 700779]
 gi|322391223|ref|ZP_08064695.1| 30S ribosomal protein S11 [Streptococcus peroris ATCC 700780]
 gi|323350964|ref|ZP_08086622.1| 30S ribosomal protein S11 [Streptococcus sanguinis VMC66]
 gi|331267110|ref|YP_004326740.1| 30S ribosomal protein S11 [Streptococcus oralis Uo5]
 gi|54039335|sp|P66360|RS11_STRR6 RecName: Full=30S ribosomal protein S11
 gi|54042111|sp|P66359|RS11_STRPN RecName: Full=30S ribosomal protein S11
 gi|122279378|sp|Q04ML2|RS11_STRP2 RecName: Full=30S ribosomal protein S11
 gi|152060826|sp|A3CK89|RS11_STRSV RecName: Full=30S ribosomal protein S11
 gi|172045616|sp|A8AZK0|RS11_STRGC RecName: Full=30S ribosomal protein S11
 gi|226708422|sp|B5E6H9|RS11_STRP4 RecName: Full=30S ribosomal protein S11
 gi|226708423|sp|B1I8M3|RS11_STRPI RecName: Full=30S ribosomal protein S11
 gi|226708424|sp|B2IS66|RS11_STRPS RecName: Full=30S ribosomal protein S11
 gi|254811045|sp|C1CAN7|RS11_STRP7 RecName: Full=30S ribosomal protein S11
 gi|254811046|sp|B8ZKQ4|RS11_STRPJ RecName: Full=30S ribosomal protein S11
 gi|254811048|sp|C1CC31|RS11_STRZJ RecName: Full=30S ribosomal protein S11
 gi|254811049|sp|C1CIC2|RS11_STRZP RecName: Full=30S ribosomal protein S11
 gi|254811050|sp|C1CPB3|RS11_STRZT RecName: Full=30S ribosomal protein S11
 gi|14971704|gb|AAK74415.1| ribosomal protein S11 [Streptococcus pneumoniae TIGR4]
 gi|15457759|gb|AAK99018.1| 30S Ribosomal protein S11 [Streptococcus pneumoniae R6]
 gi|116076017|gb|ABJ53737.1| ribosomal protein S11 [Streptococcus pneumoniae D39]
 gi|125496928|gb|ABN43594.1| 30S ribosomal protein S11, putative [Streptococcus sanguinis SK36]
 gi|147757232|gb|EDK64271.1| 30S ribosomal protein S13 [Streptococcus pneumoniae SP11-BS70]
 gi|147760116|gb|EDK67105.1| DNA-directed RNA polymerase subunit alpha [Streptococcus pneumoniae
           SP14-BS69]
 gi|147762342|gb|EDK69303.1| 30S ribosomal protein S13 [Streptococcus pneumoniae SP18-BS74]
 gi|147764741|gb|EDK71671.1| 30S ribosomal protein S13 [Streptococcus pneumoniae SP19-BS75]
 gi|147923781|gb|EDK74893.1| 30S ribosomal protein S13 [Streptococcus pneumoniae SP3-BS71]
 gi|147926436|gb|EDK77509.1| 30S ribosomal protein S13 [Streptococcus pneumoniae SP6-BS73]
 gi|147928538|gb|EDK79553.1| 30S ribosomal protein S13 [Streptococcus pneumoniae SP9-BS68]
 gi|147931489|gb|EDK82467.1| 30S ribosomal protein S13 [Streptococcus pneumoniae SP23-BS72]
 gi|157074983|gb|ABV09666.1| ribosomal protein S11 [Streptococcus gordonii str. Challis substr.
           CH1]
 gi|168994953|gb|ACA35565.1| ribosomal protein S11 [Streptococcus pneumoniae Hungary19A-6]
 gi|172042858|gb|EDT50904.1| ribosomal protein S11 [Streptococcus pneumoniae CDC1873-00]
 gi|182628546|gb|ACB89494.1| 30S ribosomal protein S11 [Streptococcus pneumoniae CGSP14]
 gi|183570842|gb|EDT91370.1| ribosomal protein S11 [Streptococcus pneumoniae CDC1087-00]
 gi|183571777|gb|EDT92305.1| ribosomal protein S11 [Streptococcus pneumoniae SP195]
 gi|183573646|gb|EDT94174.1| ribosomal protein S11 [Streptococcus pneumoniae CDC0288-04]
 gi|183576138|gb|EDT96666.1| ribosomal protein S11 [Streptococcus pneumoniae CDC3059-06]
 gi|183577864|gb|EDT98392.1| ribosomal protein S11 [Streptococcus pneumoniae MLV-016]
 gi|194357796|gb|ACF56244.1| 30S ribosomal protein S11 [Streptococcus pneumoniae G54]
 gi|220673597|emb|CAR68083.1| 30S ribosomal protein S11 [Streptococcus pneumoniae ATCC 700669]
 gi|225720663|gb|ACO16517.1| ribosomal protein S11 [Streptococcus pneumoniae 70585]
 gi|225724015|gb|ACO19868.1| ribosomal protein S11 [Streptococcus pneumoniae JJA]
 gi|225724492|gb|ACO20344.1| ribosomal protein S11 [Streptococcus pneumoniae P1031]
 gi|225728173|gb|ACO24024.1| ribosomal protein S11 [Streptococcus pneumoniae Taiwan19F-14]
 gi|262260614|gb|EEY79315.1| ribosomal protein S11 [Streptococcus sp. 2_1_36FAA]
 gi|270279553|gb|EFA25395.1| ribosomal protein S11 [Streptococcus sp. M143]
 gi|288908274|emb|CBJ23116.1| 30S ribosomal protein S11 [Streptococcus mitis B6]
 gi|301793506|emb|CBW35879.1| 30S ribosomal protein S11 [Streptococcus pneumoniae INV104]
 gi|301799382|emb|CBW31917.1| 30S ribosomal protein S11 [Streptococcus pneumoniae OXC141]
 gi|301801177|emb|CBW33850.1| 30S ribosomal protein S11 [Streptococcus pneumoniae INV200]
 gi|302597900|gb|EFL64970.1| 30S ribosomal protein S11 [Streptococcus pneumoniae BS455]
 gi|302637878|gb|EFL68364.1| 30S ribosomal protein S11 [Streptococcus pneumoniae SP14-BS292]
 gi|302639704|gb|EFL70161.1| 30S ribosomal protein S11 [Streptococcus pneumoniae SP-BS293]
 gi|302642604|gb|EFL72949.1| 30S ribosomal protein S11 [Streptococcus pneumoniae BS458]
 gi|302644974|gb|EFL75221.1| 30S ribosomal protein S11 [Streptococcus pneumoniae BS457]
 gi|302647142|gb|EFL77366.1| 30S ribosomal protein S11 [Streptococcus pneumoniae BS397]
 gi|304428985|gb|EFM32073.1| 30S ribosomal protein S11 [Streptococcus mitis ATCC 6249]
 gi|304431678|gb|EFM34658.1| 30S ribosomal protein S11 [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|306408449|gb|ADM83876.1| hypothetical protein SPAP_0283 [Streptococcus pneumoniae AP200]
 gi|306483515|gb|ADM90384.1| ribosomal protein S11 [Streptococcus pneumoniae 670-6B]
 gi|307615869|gb|EFN95074.1| ribosomal protein S11 [Streptococcus mitis NCTC 12261]
 gi|307616993|gb|EFN96171.1| 30S ribosomal protein S11 [Streptococcus mitis SK321]
 gi|307619306|gb|EFN98435.1| 30S ribosomal protein S11 [Streptococcus mitis SK564]
 gi|307622379|gb|EFO01387.1| 30S ribosomal protein S11 [Streptococcus mitis SK597]
 gi|307623826|gb|EFO02811.1| 30S ribosomal protein S11 [Streptococcus oralis ATCC 35037]
 gi|308117318|gb|EFO54741.1| ribosomal protein S11 [Streptococcus infantis SK1302]
 gi|315188097|gb|EFU21826.1| 30S ribosomal protein S11 [Streptococcus anginosus F0211]
 gi|315315337|gb|EFU63376.1| 30S ribosomal protein S11 [Streptococcus sanguinis ATCC 49296]
 gi|319747876|gb|EFW00120.1| 30S ribosomal protein S11 [Streptococcus australis ATCC 700641]
 gi|319810750|gb|EFW07077.1| 30S ribosomal protein S11 [Streptococcus anginosus 1_2_62CV]
 gi|321140690|gb|EFX36192.1| 30S ribosomal protein S11 [Streptococcus infantis ATCC 700779]
 gi|321145976|gb|EFX41365.1| 30S ribosomal protein S11 [Streptococcus peroris ATCC 700780]
 gi|321269553|gb|EFX52483.1| 30S ribosomal protein S11 [Streptococcus cristatus ATCC 51100]
 gi|321280515|gb|EFX57554.1| 30S ribosomal protein S11 [Streptococcus sp. C300]
 gi|321281919|gb|EFX58927.1| 30S ribosomal protein S11 [Streptococcus sp. M334]
 gi|322122946|gb|EFX94652.1| 30S ribosomal protein S11 [Streptococcus sanguinis VMC66]
 gi|324989978|gb|EGC21919.1| 30S ribosomal protein S11 [Streptococcus sanguinis SK353]
 gi|324991839|gb|EGC23764.1| 30S ribosomal protein S11 [Streptococcus sanguinis SK405]
 gi|324996271|gb|EGC28179.1| 30S ribosomal protein S11 [Streptococcus sanguinis SK678]
 gi|325686429|gb|EGD28459.1| 30S ribosomal protein S11 [Streptococcus sanguinis SK72]
 gi|325689207|gb|EGD31213.1| 30S ribosomal protein S11 [Streptococcus sanguinis SK115]
 gi|325695786|gb|EGD37683.1| 30S ribosomal protein S11 [Streptococcus sanguinis SK150]
 gi|325698000|gb|EGD39883.1| 30S ribosomal protein S11 [Streptococcus sanguinis SK160]
 gi|326683782|emb|CBZ01400.1| 30S ribosomal protein S11 [Streptococcus oralis Uo5]
 gi|327390652|gb|EGE88992.1| 30S ribosomal protein S11 [Streptococcus pneumoniae GA04375]
 gi|327458455|gb|EGF04811.1| 30S ribosomal protein S11 [Streptococcus sanguinis SK1]
 gi|327463698|gb|EGF10014.1| 30S ribosomal protein S11 [Streptococcus sanguinis SK1057]
 gi|327467359|gb|EGF12859.1| 30S ribosomal protein S11 [Streptococcus sanguinis SK330]
 gi|327471718|gb|EGF17159.1| 30S ribosomal protein S11 [Streptococcus sanguinis SK408]
 gi|327490439|gb|EGF22221.1| 30S ribosomal protein S11 [Streptococcus sanguinis SK1058]
 gi|328945193|gb|EGG39347.1| 30S ribosomal protein S11 [Streptococcus sanguinis SK1087]
 gi|332075899|gb|EGI86366.1| 30S ribosomal protein S11 [Streptococcus pneumoniae GA17570]
 gi|332076679|gb|EGI87141.1| 30S ribosomal protein S11 [Streptococcus pneumoniae GA17545]
 gi|332077535|gb|EGI87996.1| 30S ribosomal protein S11 [Streptococcus pneumoniae GA41301]
          Length = 127

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 71/125 (56%), Positives = 92/125 (73%), Gaps = 1/125 (0%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P+R R R +KNI SG AH+ +TFNNT + ITD HGN IAWSS   +GF GSRK++PFAAQ
Sbjct: 4   PTRKR-RVKKNIESGIAHIHATFNNTIVMITDVHGNAIAWSSAGALGFKGSRKSTPFAAQ 62

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           +A++  +  AQ HG+ S+EV V G G+GR+SA+RAL A G  + +I DVT + HNG RP 
Sbjct: 63  MASEAAAKSAQEHGLKSVEVTVKGPGSGRESAIRALAAAGLEVTAIRDVTPVPHNGARPP 122

Query: 125 KRRRI 129
           KRRR+
Sbjct: 123 KRRRV 127


>gi|228989344|ref|ZP_04149335.1| 30S ribosomal protein S11 [Bacillus pseudomycoides DSM 12442]
 gi|228995527|ref|ZP_04155195.1| 30S ribosomal protein S11 [Bacillus mycoides Rock3-17]
 gi|229003152|ref|ZP_04160998.1| 30S ribosomal protein S11 [Bacillus mycoides Rock1-4]
 gi|228758115|gb|EEM07314.1| 30S ribosomal protein S11 [Bacillus mycoides Rock1-4]
 gi|228764256|gb|EEM13135.1| 30S ribosomal protein S11 [Bacillus mycoides Rock3-17]
 gi|228770422|gb|EEM18995.1| 30S ribosomal protein S11 [Bacillus pseudomycoides DSM 12442]
          Length = 129

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT +T+TD HGN ++WSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KKRVKKNIEAGIAHIRSTFNNTIVTLTDTHGNALSWSSAGALGFRGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ +LEV V G GAGR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TAAKVAMEHGLKTLEVTVKGPGAGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|269217220|ref|ZP_06161074.1| 30S ribosomal protein S11 [Slackia exigua ATCC 700122]
 gi|269129357|gb|EEZ60442.1| 30S ribosomal protein S11 [Slackia exigua ATCC 700122]
          Length = 131

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 90/124 (72%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R++  ERKNI  G+AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++PFAAQ+
Sbjct: 8   TRVKRSERKNIAVGQAHIKSTFNNTIVSITDPQGNVISWNSAGTVGFKGSRKSTPFAAQM 67

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  +  A  HG+  + V V G G+GR++A+R+L+A G  + SI D T I HNGCRP K
Sbjct: 68  AAEQAAKNAMEHGLKKVSVFVKGPGSGRETAIRSLQAAGLEVTSIQDCTPIPHNGCRPCK 127

Query: 126 RRRI 129
           RRR+
Sbjct: 128 RRRV 131


>gi|254283381|ref|ZP_04958349.1| ribosomal protein S11 [gamma proteobacterium NOR51-B]
 gi|219679584|gb|EED35933.1| ribosomal protein S11 [gamma proteobacterium NOR51-B]
          Length = 129

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 64/129 (49%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K     + +  K +V G AHV ++FNNT +TITD  GNT++W++    GF GSRK++P
Sbjct: 1   MAKQAKTTKRKITKQVVDGVAHVHASFNNTIVTITDRQGNTLSWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     A+ +G+ +L+V+V G G GR+SA+RAL A G+ I +I DVT I HNG
Sbjct: 61  FAAQVAAERAGEAAKEYGLKNLDVQVKGPGPGRESAVRALNACGYRISNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|295109500|emb|CBL23453.1| SSU ribosomal protein S11P [Ruminococcus obeum A2-162]
          Length = 131

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 59/121 (48%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KN+  G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GSRK++P+AAQ+A +
Sbjct: 11  KRRVKKNVEHGQAHIQSSFNNTIVTLTDSEGNALSWASAGGLGFRGSRKSTPYAAQMAAE 70

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ +++V V G G+GR++A+RAL+A G  + SI DVT + HNGCRP KRRR
Sbjct: 71  TATKAALIHGLKTVDVMVKGPGSGREAAIRALQACGLEVTSIRDVTPVPHNGCRPPKRRR 130

Query: 129 I 129
           +
Sbjct: 131 V 131


>gi|291166853|gb|EFE28899.1| 30S ribosomal protein S11 [Filifactor alocis ATCC 35896]
          Length = 133

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 93/127 (73%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K  +R+R RERKNI  G AH+ S+FNN+ +T++D HGN I+W+S   +GF GSRK++PFA
Sbjct: 7   KKNARVRRRERKNIEKGHAHIQSSFNNSIVTLSDVHGNVISWASAGQLGFKGSRKSTPFA 66

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  +  A  HG+ S+EV V G G+GR++A+RAL+A G  +  I DVT I HNGCR
Sbjct: 67  AQMAAETAAKAAMEHGLRSVEVFVKGPGSGREAAIRALQASGLEVTMIKDVTPIPHNGCR 126

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 127 PPKRRRV 133


>gi|289435873|ref|YP_003465745.1| hypothetical protein lse_2512 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289172117|emb|CBH28663.1| rpsK [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|313631791|gb|EFR98971.1| 30S ribosomal protein S11 [Listeria seeligeri FSL N1-067]
 gi|313636143|gb|EFS02006.1| 30S ribosomal protein S11 [Listeria seeligeri FSL S4-171]
          Length = 129

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI SG AH+ STFNNT + ITD  GN +AWSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVKKNIESGIAHIRSTFNNTIVMITDTQGNALAWSSAGSLGFKGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  AQ HG+ +LEV V G G+GR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  SAAKSAQEHGLKTLEVTVKGPGSGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|227530230|ref|ZP_03960279.1| ribosomal protein S11 [Lactobacillus vaginalis ATCC 49540]
 gi|227349905|gb|EEJ40196.1| ribosomal protein S11 [Lactobacillus vaginalis ATCC 49540]
          Length = 129

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 91/121 (75%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KN+ +G AH+ STFNNT I ITD  GN +AWSS  V+GF GSRK++PFAAQ+A++
Sbjct: 9   KRRAKKNVETGVAHIHSTFNNTLIMITDVQGNAVAWSSAGVLGFKGSRKSTPFAAQMASE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + +A  HGM ++EV+V G G+GR+SA+RAL+A G  + +I DVT + HNG RP KRRR
Sbjct: 69  AAAKQAMEHGMKTVEVEVKGPGSGRESAIRALQATGLEVTAIRDVTPVPHNGSRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|167031522|ref|YP_001666753.1| 30S ribosomal protein S11 [Pseudomonas putida GB-1]
 gi|189040427|sp|B0KK89|RS11_PSEPG RecName: Full=30S ribosomal protein S11
 gi|166858010|gb|ABY96417.1| ribosomal protein S11 [Pseudomonas putida GB-1]
          Length = 129

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 63/129 (48%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R R + +K +V G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKPAARPRKKIKKTVVDGIAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +     A  +G+ +L+V V G G GR+SA+RAL + G+ I SI DVT I HNG
Sbjct: 61  FAAQIAAERAGQAALEYGLKNLDVNVKGPGPGRESAVRALNSCGYKIASITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|78484662|ref|YP_390587.1| 30S ribosomal protein S11 [Thiomicrospira crunogena XCL-2]
 gi|91207684|sp|Q31IW0|RS11_THICR RecName: Full=30S ribosomal protein S11
 gi|78362948|gb|ABB40913.1| SSU ribosomal protein S11P [Thiomicrospira crunogena XCL-2]
          Length = 129

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 63/129 (48%), Positives = 88/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+ SR++ + ++ +    AHV +TFNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKANSRVKKKAKQVVTDAVAHVHATFNNTIVTITDRQGNALCWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     A  +G+ +++V V G G GRDSA+R L ++GF I SI DVT I HNG
Sbjct: 61  FAAQVAAERAGQMATEYGVKNMDVMVKGPGPGRDSAVRGLNSVGFKITSISDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|160932174|ref|ZP_02079565.1| hypothetical protein CLOLEP_01009 [Clostridium leptum DSM 753]
 gi|156868776|gb|EDO62148.1| hypothetical protein CLOLEP_01009 [Clostridium leptum DSM 753]
          Length = 134

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 87/121 (71%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R RERKNI  G AH+ STFNNT +TITD  GN ++W+S   +GF GSRK++PFAAQ A +
Sbjct: 14  RRRERKNIDRGAAHIQSTFNNTIVTITDTQGNAVSWASAGELGFRGSRKSTPFAAQTAAE 73

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HGM S+EV V G G+GR++A+RAL+A G  +  I DVT I HNGCRP KRRR
Sbjct: 74  TAAKVAMEHGMKSVEVFVKGPGSGREAAIRALQAAGLEVSMIKDVTPIPHNGCRPPKRRR 133

Query: 129 I 129
           +
Sbjct: 134 V 134


>gi|156743923|ref|YP_001434052.1| 30S ribosomal protein S11 [Roseiflexus castenholzii DSM 13941]
 gi|189040430|sp|A7NR38|RS11_ROSCS RecName: Full=30S ribosomal protein S11
 gi|156235251|gb|ABU60034.1| ribosomal protein S11 [Roseiflexus castenholzii DSM 13941]
          Length = 138

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 92/124 (74%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
            R + RE+KN+  G+AH+ STFNNT +TITDP+GN + WSS    GF GSRK++P+AAQ+
Sbjct: 15  QRGKRREKKNVPRGQAHIQSTFNNTIVTITDPNGNVVCWSSAGQNGFKGSRKSTPYAAQI 74

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A ++ + KA  +GM  +EV V G GAGR++A+R+L+A G  + +I DVT I HNGCRP K
Sbjct: 75  AAENAARKAIENGMRQIEVFVKGPGAGREAAIRSLQAAGLQVTAITDVTPIPHNGCRPPK 134

Query: 126 RRRI 129
           RRR+
Sbjct: 135 RRRV 138


>gi|311744780|ref|ZP_07718576.1| 30S ribosomal protein S11 [Aeromicrobium marinum DSM 15272]
 gi|311311897|gb|EFQ81818.1| 30S ribosomal protein S11 [Aeromicrobium marinum DSM 15272]
          Length = 132

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 87/123 (70%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +E+KN+V G AH+ STFNNT +TITDP G  IAW+S   VGF GSRK++PFAA +A
Sbjct: 10  KVRRKEKKNVVQGEAHIKSTFNNTHVTITDPSGAVIAWASGGTVGFKGSRKSTPFAAGMA 69

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +    +A  HGM  ++V V G G+GR++A+R+L  +G  + +I DVT   HNGCRP K 
Sbjct: 70  AEAAGRQAMEHGMKKVDVFVKGPGSGRETAIRSLSGVGLDVGTISDVTPSPHNGCRPPKH 129

Query: 127 RRI 129
           RR+
Sbjct: 130 RRL 132


>gi|148244352|ref|YP_001219046.1| 30S ribosomal protein S11 [Candidatus Vesicomyosocius okutanii HA]
 gi|152060831|sp|A5CXI7|RS11_VESOH RecName: Full=30S ribosomal protein S11
 gi|146326179|dbj|BAF61322.1| 30S ribosomal protein S11 [Candidatus Vesicomyosocius okutanii HA]
          Length = 128

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/114 (57%), Positives = 78/114 (68%)

Query: 16  IVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQ 75
           I  G AH+ +TFNNT + ITD HGNT+ W++    GF GSRK++PFAAQVA   C  KA 
Sbjct: 15  ITDGIAHIHATFNNTIVMITDRHGNTVCWATSGGSGFRGSRKSTPFAAQVAAGSCGEKAL 74

Query: 76  NHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             GM +LEV V G G GRDSA+R L A G  I SI DVT I HNGCRP K+RR+
Sbjct: 75  AFGMKNLEVHVKGPGPGRDSAIRGLNAQGLKIQSITDVTPIPHNGCRPSKKRRV 128


>gi|241889149|ref|ZP_04776453.1| 30S ribosomal protein S11 [Gemella haemolysans ATCC 10379]
 gi|329768298|ref|ZP_08259799.1| 30S ribosomal protein S11 [Gemella haemolysans M341]
 gi|241864398|gb|EER68776.1| 30S ribosomal protein S11 [Gemella haemolysans ATCC 10379]
 gi|328837497|gb|EGF87126.1| 30S ribosomal protein S11 [Gemella haemolysans M341]
          Length = 129

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 94/127 (74%), Gaps = 1/127 (0%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K  SR R R +KNI +G AH+ STFNN+ +TITD HGN ++WSS   +GF GSRK++PFA
Sbjct: 4   KQQSRKR-RVKKNIQNGVAHIRSTFNNSIVTITDEHGNAVSWSSAGALGFKGSRKSTPFA 62

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A++  + +A  HGM  ++V V G GAGR++A+RAL++ G  + SI DVT + HNGCR
Sbjct: 63  AQMASEAAAKQAMEHGMKYVDVTVKGPGAGREAAIRALQSAGLEVTSIKDVTPVPHNGCR 122

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 123 PPKRRRV 129


>gi|187734945|ref|YP_001877057.1| ribosomal protein S11 [Akkermansia muciniphila ATCC BAA-835]
 gi|187424997|gb|ACD04276.1| ribosomal protein S11 [Akkermansia muciniphila ATCC BAA-835]
          Length = 183

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 84/125 (67%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P  ++ +  KN+ +G  HV STFNNT +T+TD  GN I WSS   +GF GSRK++ +A Q
Sbjct: 59  PKILKAKGSKNVSTGVVHVSSTFNNTVVTVTDQRGNVIGWSSAGKMGFKGSRKSTAYAGQ 118

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           V   D   +A  HG+  +EV+V G G+GR+SA+RA++ IG  I SI DVT I HNGCRP 
Sbjct: 119 VVCQDACRQAMGHGLREVEVRVKGPGSGRESAVRAVQTIGIEITSIKDVTPIPHNGCRPP 178

Query: 125 KRRRI 129
           K RR+
Sbjct: 179 KARRV 183


>gi|153812443|ref|ZP_01965111.1| hypothetical protein RUMOBE_02842 [Ruminococcus obeum ATCC 29174]
 gi|149831368|gb|EDM86456.1| hypothetical protein RUMOBE_02842 [Ruminococcus obeum ATCC 29174]
          Length = 131

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 59/121 (48%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KN+  G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GSRK++P+AAQ+A +
Sbjct: 11  KRRVKKNVEHGQAHIQSSFNNTIVTLTDSEGNALSWASAGGLGFRGSRKSTPYAAQMAAE 70

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ +++V V G G+GR++A+RAL+A G  + SI DVT + HNGCRP KRRR
Sbjct: 71  TATKAALIHGLKTVDVMVKGPGSGREAAIRALQACGLEVTSIRDVTPVPHNGCRPPKRRR 130

Query: 129 I 129
           +
Sbjct: 131 V 131


>gi|297180259|gb|ADI16478.1| hypothetical protein [uncultured bacterium HF4000_05M23]
          Length = 127

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 91/129 (70%), Gaps = 2/129 (1%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           MP+   R R RE+K +  G+A++ +TFNNT IT+TDP GN I+ SS   +GF GSRK++ 
Sbjct: 1   MPRQ--RTRRREKKFVPQGKAYINATFNNTLITLTDPQGNVISQSSAGAMGFRGSRKSTA 58

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ A +  +  A  HG+ ++ V V G GAGR++A+RA++A G  +VSI DVT + HNG
Sbjct: 59  FAAQRAGETAAHSAIEHGLKTVNVMVKGPGAGREAAIRAIQAAGIRVVSIRDVTSVPHNG 118

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 119 CRPPKKRRV 127


>gi|53803439|ref|YP_114765.1| 30S ribosomal protein S11 [Methylococcus capsulatus str. Bath]
 gi|59798625|sp|Q605D5|RS11_METCA RecName: Full=30S ribosomal protein S11
 gi|53757200|gb|AAU91491.1| ribosomal protein S11 [Methylococcus capsulatus str. Bath]
          Length = 128

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 88/119 (73%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           R +++I  G AH+ ++FNNT ITITD  GN ++W+S    GF GSRK++PFAAQVA +  
Sbjct: 10  RVKRDISDGIAHISASFNNTIITITDRKGNALSWASAGASGFRGSRKSTPFAAQVAAEKA 69

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            A A+ +G+ +L+V V+G G GR+SA+R+L A+GF IV++ D T + HNGCRP K+RR+
Sbjct: 70  GAVAKEYGIKNLDVHVTGPGPGRESAVRSLNALGFKIVNVVDTTPLPHNGCRPPKKRRV 128


>gi|15610595|ref|NP_217976.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis H37Rv]
 gi|15843054|ref|NP_338091.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis CDC1551]
 gi|148663324|ref|YP_001284847.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis H37Ra]
 gi|148824669|ref|YP_001289423.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis F11]
 gi|167966774|ref|ZP_02549051.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis H37Ra]
 gi|215405498|ref|ZP_03417679.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis 02_1987]
 gi|215413373|ref|ZP_03422057.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis 94_M4241A]
 gi|215428966|ref|ZP_03426885.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis T92]
 gi|215432430|ref|ZP_03430349.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis EAS054]
 gi|218755237|ref|ZP_03534033.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis GM 1503]
 gi|219559527|ref|ZP_03538603.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis T17]
 gi|253800504|ref|YP_003033505.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis KZN
           1435]
 gi|254234051|ref|ZP_04927376.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis C]
 gi|254366060|ref|ZP_04982105.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254552562|ref|ZP_05143009.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis '98-R604
           INH-RIF-EM']
 gi|260202642|ref|ZP_05770133.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis T46]
 gi|289445059|ref|ZP_06434803.1| SSU ribosomal protein S11 [Mycobacterium tuberculosis T46]
 gi|289555730|ref|ZP_06444940.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis KZN 605]
 gi|289571693|ref|ZP_06451920.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis T17]
 gi|289747292|ref|ZP_06506670.1| ribosomal protein S11 [Mycobacterium tuberculosis 02_1987]
 gi|289752183|ref|ZP_06511561.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis T92]
 gi|289755592|ref|ZP_06514970.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis EAS054]
 gi|289763641|ref|ZP_06523019.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis GM 1503]
 gi|297636118|ref|ZP_06953898.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis KZN 4207]
 gi|297733118|ref|ZP_06962236.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis KZN R506]
 gi|298526943|ref|ZP_07014352.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis 94_M4241A]
 gi|306782525|ref|ZP_07420862.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis SUMu002]
 gi|306786344|ref|ZP_07424666.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis SUMu003]
 gi|306790713|ref|ZP_07429035.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis SUMu004]
 gi|306799431|ref|ZP_07437733.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis SUMu006]
 gi|306809463|ref|ZP_07446131.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis SUMu007]
 gi|306969571|ref|ZP_07482232.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis SUMu009]
 gi|306973925|ref|ZP_07486586.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis SUMu010]
 gi|307081634|ref|ZP_07490804.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis SUMu011]
 gi|307086240|ref|ZP_07495353.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis SUMu012]
 gi|313660449|ref|ZP_07817329.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis KZN V2475]
 gi|6094147|sp|O06326|RS11_MYCTU RecName: Full=30S ribosomal protein S11
 gi|166231819|sp|A5U8D5|RS11_MYCTA RecName: Full=30S ribosomal protein S11
 gi|2104382|emb|CAB08725.1| PROBABLE 30S RIBOSOMAL PROTEIN S11 RPSK [Mycobacterium tuberculosis
           H37Rv]
 gi|13883398|gb|AAK47905.1| ribosomal protein S11 [Mycobacterium tuberculosis CDC1551]
 gi|124599580|gb|EAY58684.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis C]
 gi|134151573|gb|EBA43618.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148507476|gb|ABQ75285.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis H37Ra]
 gi|148723196|gb|ABR07821.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis F11]
 gi|253322007|gb|ACT26610.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis KZN
           1435]
 gi|289417978|gb|EFD15218.1| SSU ribosomal protein S11 [Mycobacterium tuberculosis T46]
 gi|289440362|gb|EFD22855.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis KZN 605]
 gi|289545447|gb|EFD49095.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis T17]
 gi|289687820|gb|EFD55308.1| ribosomal protein S11 [Mycobacterium tuberculosis 02_1987]
 gi|289692770|gb|EFD60199.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis T92]
 gi|289696179|gb|EFD63608.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis EAS054]
 gi|289711147|gb|EFD75163.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis GM 1503]
 gi|298496737|gb|EFI32031.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis 94_M4241A]
 gi|308324842|gb|EFP13693.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis SUMu002]
 gi|308329096|gb|EFP17947.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis SUMu003]
 gi|308332904|gb|EFP21755.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis SUMu004]
 gi|308340439|gb|EFP29290.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis SUMu006]
 gi|308344303|gb|EFP33154.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis SUMu007]
 gi|308352918|gb|EFP41769.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis SUMu009]
 gi|308356761|gb|EFP45612.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis SUMu010]
 gi|308360706|gb|EFP49557.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis SUMu011]
 gi|308364321|gb|EFP53172.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis SUMu012]
 gi|323717943|gb|EGB27132.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis
           CDC1551A]
 gi|326905305|gb|EGE52238.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis W-148]
 gi|328460235|gb|AEB05658.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis KZN
           4207]
          Length = 139

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 92/124 (74%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
            + R RE+KN+  G AH+ STFNNT +TITDP GN IAW+S   VGF GSRK++PFAAQ+
Sbjct: 16  QKTRRREKKNVPHGAAHIKSTFNNTIVTITDPQGNVIAWASSGHVGFKGSRKSTPFAAQL 75

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A ++ + KAQ+HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNG RP K
Sbjct: 76  AAENAARKAQDHGVRKVDVFVKGPGSGRETAIRSLQAAGLEVGAISDVTPQPHNGVRPPK 135

Query: 126 RRRI 129
           RRR+
Sbjct: 136 RRRV 139


>gi|30918396|sp|P10789|RS11_BACST RecName: Full=30S ribosomal protein S11; Short=BS11
          Length = 129

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R RKNI +G AH+ STFNNT +TITD HGN +AW+S   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVRKNIDTGIAHIRSTFNNTIVTITDVHGNALAWASAGSLGFKGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  +  HGM ++EV V G GAGR++A+RAL+A G  I +I DVT I H+GCRP KRRR
Sbjct: 69  AAAKASMEHGMKTVEVNVKGPGAGREAAIRALQAAGLEITAIKDVTPIPHDGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|313897174|ref|ZP_07830718.1| ribosomal protein S11 [Clostridium sp. HGF2]
 gi|312957895|gb|EFR39519.1| ribosomal protein S11 [Clostridium sp. HGF2]
          Length = 132

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 68/126 (53%), Positives = 85/126 (67%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K+ SR + + RKNI  G AHV STFNNT +TITD +GN +AWSS   +GF GSRK++PFA
Sbjct: 6   KANSRGKRKARKNIARGVAHVHSTFNNTIVTITDENGNAVAWSSAGALGFKGSRKSTPFA 65

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +     A  +GM  + V V G G GR++A+RAL+  G  I  I DVT I HNGCR
Sbjct: 66  AQMAGEAAGKAAIENGMKVIAVSVKGPGPGREAAVRALQVAGLEITLINDVTPIPHNGCR 125

Query: 123 PRKRRR 128
           P KR R
Sbjct: 126 PPKRPR 131


>gi|240167781|ref|ZP_04746440.1| 30S ribosomal protein S11 [Mycobacterium kansasii ATCC 12478]
          Length = 142

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 91/124 (73%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
            + R RE+KN+  G AH+ STFNNT +TITDP GN IAW+S   VGF GSRK++PFAAQ+
Sbjct: 19  QKTRRREKKNVPHGAAHIKSTFNNTIVTITDPQGNVIAWASSGHVGFKGSRKSTPFAAQL 78

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A ++ + KAQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNG RP K
Sbjct: 79  AAENAARKAQEHGVRKVDVFVKGPGSGRETAIRSLQAAGLEVGAISDVTPQPHNGVRPPK 138

Query: 126 RRRI 129
           RRR+
Sbjct: 139 RRRV 142


>gi|329770015|ref|ZP_08261410.1| 30S ribosomal protein S11 [Gemella sanguinis M325]
 gi|328837326|gb|EGF86956.1| 30S ribosomal protein S11 [Gemella sanguinis M325]
          Length = 129

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 94/127 (74%), Gaps = 1/127 (0%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K  SR R R +KNI +G AH+ STFNN+ +TITD HGN ++WSS   +GF GSRK++PFA
Sbjct: 4   KQQSRKR-RVKKNIQNGIAHIRSTFNNSIVTITDEHGNAVSWSSAGALGFKGSRKSTPFA 62

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A++  + +A  HGM  ++V V G GAGR++A+RAL++ G  + SI DVT + HNGCR
Sbjct: 63  AQMASEAAAKQAMEHGMKYVDVTVKGPGAGREAAIRALQSAGLEVTSIKDVTPVPHNGCR 122

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 123 PPKRRRV 129


>gi|218284160|ref|ZP_03489954.1| hypothetical protein EUBIFOR_02559 [Eubacterium biforme DSM 3989]
 gi|218215353|gb|EEC88891.1| hypothetical protein EUBIFOR_02559 [Eubacterium biforme DSM 3989]
          Length = 129

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 83/120 (69%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI  G AH+ STFNNT +TITD +GN +AWSS   +GF GSRK++P+AAQ+A +
Sbjct: 9   KRRVKKNIARGCAHIHSTFNNTIVTITDENGNAVAWSSAGALGFKGSRKSTPYAAQLAGE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
                A +HGM ++ V V G G GR++A+RAL+  G  I  I DVT I HNGCRP KR R
Sbjct: 69  AAGKAAMDHGMKTVSVDVKGPGPGREAAVRALQVAGLEITMINDVTPIPHNGCRPPKRPR 128


>gi|226202|prf||1501255A ribosomal protein S11
          Length = 128

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R RKNI +G AH+ STFNNT +TITD HGN +AW+S   +GF GSRK++PFAAQ+A +
Sbjct: 8   KRRVRKNIDTGIAHIRSTFNNTIVTITDVHGNALAWASAGSLGFKGSRKSTPFAAQMAAE 67

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  +  HGM ++EV V G GAGR++A+RAL+A G  I +I DVT I H+GCRP KRRR
Sbjct: 68  AAAKASMEHGMKTVEVNVKGPGAGREAAIRALQAAGLEITAIKDVTPIPHDGCRPPKRRR 127

Query: 129 I 129
           +
Sbjct: 128 V 128


>gi|116515236|ref|YP_802865.1| 30S ribosomal protein S11 [Buchnera aphidicola str. Cc (Cinara
           cedri)]
 gi|122285368|sp|Q057C7|RS11_BUCCC RecName: Full=30S ribosomal protein S11
 gi|58384669|gb|AAW72684.1| 30S ribosomal protein S11 [Buchnera aphidicola (Cinara cedri)]
 gi|116257090|gb|ABJ90772.1| 30S ribosomal protein S11 [Buchnera aphidicola str. Cc (Cinara
           cedri)]
          Length = 130

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 88/121 (72%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R ++ I+ G AH+ ++FNNT +TITD  GNT+ W++    GF GSRK++PFAAQVA +
Sbjct: 10  KKRIKRQILDGIAHIHASFNNTIVTITDRKGNTLGWATSGGSGFRGSRKSTPFAAQVAAE 69

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
            C+ + +++G+ +LEV + G G GR+S +RAL + GF I +I DVT I HNGCRP K+RR
Sbjct: 70  KCADRVKDYGIKNLEVMIKGPGPGRESTIRALNSSGFRITNIIDVTPIPHNGCRPSKKRR 129

Query: 129 I 129
           +
Sbjct: 130 V 130


>gi|253580646|ref|ZP_04857910.1| 30S ribosomal protein S11 [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848017|gb|EES75983.1| 30S ribosomal protein S11 [Ruminococcus sp. 5_1_39BFAA]
          Length = 131

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 59/121 (48%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KN+  G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GSRK++P+AAQ+A +
Sbjct: 11  KRRVKKNVEHGQAHIQSSFNNTIVTLTDNEGNALSWASAGGLGFRGSRKSTPYAAQMAAE 70

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ +++V V G G+GR++A+RAL+A G  + SI DVT + HNGCRP KRRR
Sbjct: 71  TATKAALIHGLKTVDVMVKGPGSGREAAIRALQACGLEVTSIRDVTPVPHNGCRPPKRRR 130

Query: 129 I 129
           +
Sbjct: 131 V 131


>gi|119478109|ref|ZP_01618188.1| Ribosomal protein S11 [marine gamma proteobacterium HTCC2143]
 gi|119448815|gb|EAW30058.1| Ribosomal protein S11 [marine gamma proteobacterium HTCC2143]
          Length = 129

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 88/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K     R + +K +V G AH+ ++FNNT ITITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKDNKPARKKVKKTVVDGIAHIHASFNNTIITITDRQGNALSWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     AQ +G+ +L+V+V G G GR+SA+RAL   G+ I SI DVT I HNG
Sbjct: 61  FAAQVAAERAGIAAQEYGLKNLDVEVKGPGPGRESAVRALNNAGYKIGSINDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|299143168|ref|ZP_07036248.1| 30S ribosomal protein S11 [Peptoniphilus sp. oral taxon 386 str.
           F0131]
 gi|298517653|gb|EFI41392.1| 30S ribosomal protein S11 [Peptoniphilus sp. oral taxon 386 str.
           F0131]
          Length = 131

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 68/124 (54%), Positives = 93/124 (75%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R+R RERKNI  G+AH+ STFNNT +T+TD  GN I+W+S   +GF GSRK++PFAAQ 
Sbjct: 8   TRVRRRERKNIEKGQAHIASTFNNTMVTLTDMSGNVISWASAGQLGFRGSRKSTPFAAQE 67

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  ++KA+ HG+ S+EV V G G+GR++A+R+L+A G  +  I D T I HNGCRP K
Sbjct: 68  AAESAASKAKEHGLKSVEVFVKGPGSGREAAIRSLQASGLEVTMIKDETPIPHNGCRPPK 127

Query: 126 RRRI 129
           RRR+
Sbjct: 128 RRRV 131


>gi|300857221|ref|YP_003782205.1| 30S ribosomal protein S11 [Clostridium ljungdahlii DSM 13528]
 gi|300437336|gb|ADK17103.1| 30S ribosomal protein S11 [Clostridium ljungdahlii DSM 13528]
          Length = 132

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 84/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G AH+ STFNN+ +TITD  GNT++W+S   +GF GSRK++PFAAQ+A +  +  A
Sbjct: 18  NVEHGCAHIRSTFNNSIVTITDAAGNTLSWASAGGLGFRGSRKSTPFAAQMAAETSAKAA 77

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ S+EV V G GAGR++A+R+L+A G  +  I DVT I HNGCRP KRRR+
Sbjct: 78  MEHGLKSIEVYVKGPGAGREAAIRSLQAAGLEVTLIKDVTPIPHNGCRPPKRRRV 132


>gi|167629494|ref|YP_001679993.1| 30S ribosomal protein s11 [Heliobacterium modesticaldum Ice1]
 gi|167592234|gb|ABZ83982.1| 30S ribosomal protein s11 [Heliobacterium modesticaldum Ice1]
          Length = 131

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 93/124 (75%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R + +ERK++  G AH+ STFNNT +TITDP+GNTI+W+S  V+GF GSRK++PFAAQ+
Sbjct: 8   TRTKRKERKHVDRGVAHIKSTFNNTIVTITDPNGNTISWASAGVLGFKGSRKSTPFAAQM 67

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  + +A  HG+  +E  V G G+GR++A+R+L+A G  +  I DVT I HNGCRP K
Sbjct: 68  AAESAAKEAMEHGLREVECLVKGPGSGREAAIRSLQAAGLEVNMIKDVTPIPHNGCRPPK 127

Query: 126 RRRI 129
           RRR+
Sbjct: 128 RRRV 131


>gi|294055198|ref|YP_003548856.1| 30S ribosomal protein S11 [Coraliomargarita akajimensis DSM 45221]
 gi|293614531|gb|ADE54686.1| 30S ribosomal protein S11 [Coraliomargarita akajimensis DSM 45221]
          Length = 170

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 83/121 (68%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +  KNI SG  +V++TFNNT++T TD  GN I+WSS     F GSRK++ +AAQV T 
Sbjct: 50  RAKGSKNITSGIVNVLATFNNTKVTFTDARGNVISWSSAGKCNFRGSRKSTAYAAQVVTQ 109

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           D    A +HGM  + VK+ G G GRDSA+RAL+++G  +  I DVT + HNGCRP KRRR
Sbjct: 110 DAGRVAISHGMKEVVVKLKGPGMGRDSAVRALQSLGMVVTEIIDVTPVPHNGCRPPKRRR 169

Query: 129 I 129
           +
Sbjct: 170 V 170


>gi|226309834|ref|YP_002769728.1| 30S ribosomal protein S11 [Brevibacillus brevis NBRC 100599]
 gi|254765369|sp|C0ZIK6|RS11_BREBN RecName: Full=30S ribosomal protein S11
 gi|226092782|dbj|BAH41224.1| 30S ribosomal protein S11 [Brevibacillus brevis NBRC 100599]
          Length = 133

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 86/116 (74%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           KN+  G AH+ STFNNT +TITDPHGN I+WSS   +GF GSRK++PFAAQ+A +  +  
Sbjct: 18  KNVEVGVAHIRSTFNNTIVTITDPHGNAISWSSAGSLGFKGSRKSTPFAAQMAAEAAARV 77

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           A  HGM SLEV V G GAGR++A+R+L+A G  +  I DVT I HNGCRP KRRR+
Sbjct: 78  AMEHGMRSLEVSVKGPGAGREAAIRSLQATGLEVNMIKDVTPIPHNGCRPPKRRRV 133


>gi|146319945|ref|YP_001199656.1| 30S ribosomal protein S11 [Streptococcus suis 98HAH33]
 gi|253751014|ref|YP_003024155.1| 30S ribosomal protein S11 [Streptococcus suis SC84]
 gi|253752914|ref|YP_003026054.1| 30S ribosomal protein S11 [Streptococcus suis P1/7]
 gi|253754739|ref|YP_003027879.1| 30S ribosomal protein S11 [Streptococcus suis BM407]
 gi|330831945|ref|YP_004400770.1| 30S ribosomal protein S11 [Streptococcus suis ST3]
 gi|152060825|sp|A4VYR7|RS11_STRS2 RecName: Full=30S ribosomal protein S11
 gi|152060827|sp|A4VSH7|RS11_STRSY RecName: Full=30S ribosomal protein S11
 gi|145690751|gb|ABP91256.1| 30S ribosomal protein S11 [Streptococcus suis 98HAH33]
 gi|251815303|emb|CAZ50871.1| 30S ribosomal protein S11 [Streptococcus suis SC84]
 gi|251817203|emb|CAZ54926.1| 30S ribosomal protein S11 [Streptococcus suis BM407]
 gi|251819159|emb|CAR44292.1| 30S ribosomal protein S11 [Streptococcus suis P1/7]
 gi|292557556|gb|ADE30557.1| ribosomal protein S11 [Streptococcus suis GZ1]
 gi|319757265|gb|ADV69207.1| 30S ribosomal protein S11 [Streptococcus suis JS14]
 gi|329306168|gb|AEB80584.1| 30S ribosomal protein S11 [Streptococcus suis ST3]
          Length = 127

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 92/125 (73%), Gaps = 1/125 (0%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P+R R R +KNI SG AH+ +TFNNT + ITD HGN IAWSS   +GF GSRK++PFAAQ
Sbjct: 4   PTRKR-RVKKNIESGIAHIHATFNNTIVMITDVHGNAIAWSSAGALGFKGSRKSTPFAAQ 62

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           +A++  +  AQ HG+ ++EV V G G+GR+SA+RAL A G  + +I DVT + HNG RP 
Sbjct: 63  MASEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLEVTAIRDVTPVPHNGARPP 122

Query: 125 KRRRI 129
           KRRR+
Sbjct: 123 KRRRV 127


>gi|16077210|ref|NP_388023.1| 30S ribosomal protein S11 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221307955|ref|ZP_03589802.1| 30S ribosomal protein S11 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221312276|ref|ZP_03594081.1| 30S ribosomal protein S11 [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221317210|ref|ZP_03598504.1| 30S ribosomal protein S11 [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221321473|ref|ZP_03602767.1| 30S ribosomal protein S11 [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|321313814|ref|YP_004206101.1| 30S ribosomal protein S11 [Bacillus subtilis BSn5]
 gi|133719|sp|P04969|RS11_BACSU RecName: Full=30S ribosomal protein S11; Short=BS11
 gi|142462|gb|AAA22216.1| ribosomal protein S11 [Bacillus subtilis]
 gi|143451|gb|AAA22707.1| ribosomal protein S11 [Bacillus subtilis]
 gi|1044990|gb|AAB06825.1| ribosomal protein S11 [Bacillus subtilis]
 gi|2632409|emb|CAB11918.1| ribosomal protein S11 (BS11) [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|291482514|dbj|BAI83589.1| 30S ribosomal protein S11 [Bacillus subtilis subsp. natto BEST195]
 gi|320020088|gb|ADV95074.1| 30S ribosomal protein S11 [Bacillus subtilis BSn5]
          Length = 131

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 71/127 (55%), Positives = 94/127 (74%), Gaps = 1/127 (0%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           KS +R R R +KNI SG AH+ STFNNT +TITD HGN I+WSS   +GF GSRK++PFA
Sbjct: 6   KSNTRKR-RVKKNIESGIAHIRSTFNNTIVTITDTHGNAISWSSAGALGFRGSRKSTPFA 64

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  +  +  HG+ +LEV V G G+GR++A+RAL+A G  + +I DVT + HNGCR
Sbjct: 65  AQMAAETAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQAAGLEVTAIRDVTPVPHNGCR 124

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 125 PPKRRRV 131


>gi|254819219|ref|ZP_05224220.1| 30S ribosomal protein S11 [Mycobacterium intracellulare ATCC 13950]
          Length = 138

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 91/124 (73%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
            + R RE+KN+  G AH+ STFNNT +TITDP GN IAW+S   VGF GSRK++PFAAQ+
Sbjct: 15  QKTRRREKKNVPHGAAHIKSTFNNTIVTITDPQGNVIAWASSGHVGFKGSRKSTPFAAQL 74

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A ++ + KAQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNG RP K
Sbjct: 75  AAENAARKAQEHGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGAISDVTPQPHNGVRPPK 134

Query: 126 RRRI 129
           RRR+
Sbjct: 135 RRRV 138


>gi|119502946|ref|ZP_01625031.1| 30S ribosomal protein S11 [marine gamma proteobacterium HTCC2080]
 gi|119461292|gb|EAW42382.1| 30S ribosomal protein S11 [marine gamma proteobacterium HTCC2080]
          Length = 132

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 85/116 (73%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           K +V G AHV ++FNNT +TITD  GNT++W++    GF GSRK++PFAAQVA +     
Sbjct: 17  KQVVDGVAHVHASFNNTIVTITDRQGNTLSWATAGGSGFRGSRKSTPFAAQVAAERAGEA 76

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           A+ +G+ +L+V+V G G GR+SA+RAL + G+ I +I DVT I HNGCRP K+RR+
Sbjct: 77  AKEYGLKNLDVQVKGPGPGRESAVRALNSCGYKITNITDVTPIPHNGCRPPKKRRV 132


>gi|169830462|ref|YP_001716444.1| ribosomal protein S11 [Candidatus Desulforudis audaxviator MP104C]
 gi|254765379|sp|B1I1B1|RS11_DESAP RecName: Full=30S ribosomal protein S11
 gi|169637306|gb|ACA58812.1| ribosomal protein S11 [Candidatus Desulforudis audaxviator MP104C]
          Length = 128

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 89/123 (72%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R + +ERKNI +G AH+ STFNNT ITI+D  GN I+WSS   VGF GSRK++PFAAQ+A
Sbjct: 6   RAKKKERKNIETGVAHIKSTFNNTVITISDVRGNAISWSSAGTVGFKGSRKSTPFAAQLA 65

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +A  HGM  + V V G GAGR++A+R+L+A G  +  I DVT I HNGCRP KR
Sbjct: 66  AEKAAREAMEHGMREVAVMVKGPGAGREAAIRSLQAAGLEVSLIKDVTPIPHNGCRPPKR 125

Query: 127 RRI 129
           RR+
Sbjct: 126 RRV 128


>gi|117927541|ref|YP_872092.1| 30S ribosomal protein S11 [Acidothermus cellulolyticus 11B]
 gi|152060566|sp|A0LRP6|RS11_ACIC1 RecName: Full=30S ribosomal protein S11
 gi|117648004|gb|ABK52106.1| SSU ribosomal protein S11P [Acidothermus cellulolyticus 11B]
          Length = 135

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 92/123 (74%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +E+KN+  G AH+ STFNNT ++ITDP G  IAW+S   VGF GSRK++PFAAQ+ 
Sbjct: 13  KVRRKEKKNVAHGHAHIKSTFNNTIVSITDPSGAVIAWASAGQVGFKGSRKSTPFAAQMT 72

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +AQ HGM  ++V V G G+GR++A+R+L+A+G  + SI DVT + HNGCRP KR
Sbjct: 73  AEAAARRAQEHGMRKVDVFVKGPGSGRETAIRSLQAVGLEVGSIQDVTPVPHNGCRPPKR 132

Query: 127 RRI 129
           RR+
Sbjct: 133 RRV 135


>gi|148544671|ref|YP_001272041.1| 30S ribosomal protein S11 [Lactobacillus reuteri DSM 20016]
 gi|184154024|ref|YP_001842365.1| 30S ribosomal protein S11 [Lactobacillus reuteri JCM 1112]
 gi|194466928|ref|ZP_03072915.1| ribosomal protein S11 [Lactobacillus reuteri 100-23]
 gi|227363794|ref|ZP_03847901.1| ribosomal protein S11 [Lactobacillus reuteri MM2-3]
 gi|227543598|ref|ZP_03973647.1| ribosomal protein S11 [Lactobacillus reuteri CF48-3A]
 gi|259502555|ref|ZP_05745457.1| 30S ribosomal protein S11 [Lactobacillus antri DSM 16041]
 gi|300909373|ref|ZP_07126834.1| 30S ribosomal protein S11 [Lactobacillus reuteri SD2112]
 gi|312870515|ref|ZP_07730634.1| 30S ribosomal protein S11 [Lactobacillus oris PB013-T2-3]
 gi|325683005|ref|ZP_08162521.1| 30S ribosomal protein S11 [Lactobacillus reuteri MM4-1A]
 gi|166991580|sp|A5VLI0|RS11_LACRD RecName: Full=30S ribosomal protein S11
 gi|226708381|sp|B2G8V3|RS11_LACRJ RecName: Full=30S ribosomal protein S11
 gi|148531705|gb|ABQ83704.1| SSU ribosomal protein S11P [Lactobacillus reuteri DSM 20016]
 gi|154705528|gb|ABS84190.1| ribosomal protein S11 [Lactobacillus reuteri]
 gi|183225368|dbj|BAG25885.1| 30S ribosomal protein S11 [Lactobacillus reuteri JCM 1112]
 gi|194453964|gb|EDX42861.1| ribosomal protein S11 [Lactobacillus reuteri 100-23]
 gi|227071151|gb|EEI09467.1| ribosomal protein S11 [Lactobacillus reuteri MM2-3]
 gi|227186438|gb|EEI66509.1| ribosomal protein S11 [Lactobacillus reuteri CF48-3A]
 gi|259169507|gb|EEW54002.1| 30S ribosomal protein S11 [Lactobacillus antri DSM 16041]
 gi|300893238|gb|EFK86597.1| 30S ribosomal protein S11 [Lactobacillus reuteri SD2112]
 gi|311093977|gb|EFQ52302.1| 30S ribosomal protein S11 [Lactobacillus oris PB013-T2-3]
 gi|324977355|gb|EGC14306.1| 30S ribosomal protein S11 [Lactobacillus reuteri MM4-1A]
          Length = 129

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 91/121 (75%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KN+ +G AH+ STFNNT I ITD  GN +AWSS  V+GF GSRK++PFAAQ+A++
Sbjct: 9   KRRAKKNVETGVAHIHSTFNNTLIMITDVQGNAVAWSSAGVLGFKGSRKSTPFAAQMASE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + +A  HGM ++EV+V G G+GR++A+RAL+A G  + +I DVT + HNG RP KRRR
Sbjct: 69  AAAKQAMEHGMKTVEVEVKGPGSGREAAIRALQATGLEVTAIRDVTPVPHNGSRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|308172033|ref|YP_003918738.1| 30S ribosomal protein S11 (BS11) [Bacillus amyloliquefaciens DSM 7]
 gi|307604897|emb|CBI41268.1| ribosomal protein S11 (BS11) [Bacillus amyloliquefaciens DSM 7]
 gi|328551843|gb|AEB22335.1| 30S ribosomal protein S11 [Bacillus amyloliquefaciens TA208]
          Length = 131

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI SG AH+ STFNNT +TITD HGN I+WSS   +GF GSRK++PFAAQ+A +
Sbjct: 11  KRRVKKNIESGIAHIRSTFNNTIVTITDTHGNAISWSSAGALGFRGSRKSTPFAAQMAAE 70

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  +  HG+ +LEV V G G+GR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 71  TAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRR 130

Query: 129 I 129
           +
Sbjct: 131 V 131


>gi|317496165|ref|ZP_07954525.1| 30S ribosomal protein S11 [Gemella moribillum M424]
 gi|316913740|gb|EFV35226.1| 30S ribosomal protein S11 [Gemella moribillum M424]
          Length = 129

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 94/127 (74%), Gaps = 1/127 (0%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K  SR R R +KNI +G AH+ STFNN+ +TITD HGN ++WSS   +GF GSRK++PFA
Sbjct: 4   KQQSRKR-RVKKNIQNGIAHIRSTFNNSIVTITDEHGNAVSWSSAGALGFKGSRKSTPFA 62

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A++  + +A  HGM  ++V V G GAGR++A+RAL++ G  + SI DVT + HNGCR
Sbjct: 63  AQMASEAAAKQAMEHGMRYVDVTVKGPGAGREAAIRALQSAGLEVTSIKDVTPVPHNGCR 122

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 123 PPKRRRV 129


>gi|261367776|ref|ZP_05980659.1| 30S ribosomal protein S11 [Subdoligranulum variabile DSM 15176]
 gi|282570574|gb|EFB76109.1| 30S ribosomal protein S11 [Subdoligranulum variabile DSM 15176]
          Length = 134

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 88/123 (71%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R + RERKNI +G AH+ STFNNT +TITD  GNT++W S   + F GSRK++P+AAQ A
Sbjct: 12  RTKKRERKNISAGAAHIQSTFNNTIVTITDTQGNTVSWCSTGALNFRGSRKSTPYAAQSA 71

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  +  A  HGM ++EV V G G+GR+SA+RAL+A G  +  I DVT I HNGCRP KR
Sbjct: 72  AEVAAKAAIEHGMKTVEVYVKGPGSGRESAIRALQATGLEVTMIRDVTPIPHNGCRPPKR 131

Query: 127 RRI 129
           RR+
Sbjct: 132 RRV 134


>gi|229815745|ref|ZP_04446070.1| hypothetical protein COLINT_02794 [Collinsella intestinalis DSM
           13280]
 gi|229808661|gb|EEP44438.1| hypothetical protein COLINT_02794 [Collinsella intestinalis DSM
           13280]
          Length = 135

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 69/124 (55%), Positives = 91/124 (73%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +RI+  +RKNI  G+AH+ STFNNT ++ITDP GN IAW S   VGF GSRK++PFAAQ+
Sbjct: 12  TRIKRADRKNISVGQAHIRSTFNNTIVSITDPAGNVIAWQSAGTVGFKGSRKSTPFAAQM 71

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A + C+  A  HGM  + V V G G+GR++A+R+L+A G  + SI D T I HNGCRP+K
Sbjct: 72  AAEACAKAAMEHGMHKVAVFVKGPGSGRETAIRSLQAAGLEVASIQDKTPIPHNGCRPKK 131

Query: 126 RRRI 129
           RRR+
Sbjct: 132 RRRV 135


>gi|311070790|ref|YP_003975713.1| 30S ribosomal protein S11 [Bacillus atrophaeus 1942]
 gi|310871307|gb|ADP34782.1| 30S ribosomal protein S11 [Bacillus atrophaeus 1942]
          Length = 131

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI SG AH+ STFNNT +TITD HGN I+WSS   +GF GSRK++PFAAQ+A +
Sbjct: 11  KRRVKKNIESGIAHIRSTFNNTIVTITDTHGNAISWSSAGALGFRGSRKSTPFAAQMAAE 70

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  +  HG+ +LEV V G G+GR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 71  TAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRR 130

Query: 129 I 129
           +
Sbjct: 131 V 131


>gi|329121854|ref|ZP_08250469.1| 30S ribosomal protein S11 [Dialister micraerophilus DSM 19965]
 gi|327467792|gb|EGF13284.1| 30S ribosomal protein S11 [Dialister micraerophilus DSM 19965]
          Length = 127

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 71/121 (58%), Positives = 92/121 (76%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + RERK++ +G AH+ STFNNT +TITD +GNTI+W+S   +GF GSRK++PFAAQ+A +
Sbjct: 7   KRRERKHVETGAAHIRSTFNNTIVTITDSNGNTISWASAGELGFRGSRKSTPFAAQMAAE 66

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A +HGM S +V V G GAGR++A+RAL+A G  I SI DVT I HNGCRP KRRR
Sbjct: 67  KAAKVAIDHGMRSADVFVKGPGAGREAAIRALQAAGIEISSIKDVTPIPHNGCRPPKRRR 126

Query: 129 I 129
           I
Sbjct: 127 I 127


>gi|182412028|ref|YP_001817094.1| ribosomal protein S11 [Opitutus terrae PB90-1]
 gi|177839242|gb|ACB73494.1| ribosomal protein S11 [Opitutus terrae PB90-1]
          Length = 126

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 83/116 (71%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           KN+ SG A+V+++FNNT ++ITD  G  I+WSS     F GSRK++ +AAQ+   D +  
Sbjct: 11  KNVTSGVANVLASFNNTIVSITDQQGRVISWSSAGKCNFRGSRKSTAYAAQIVAQDAARN 70

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           A  HG+  + +++SG G GRDSA+RAL+A+G  I SI DVT I HNGCRPRKRRR+
Sbjct: 71  AMAHGLKDIVIRISGPGLGRDSAVRALQAVGLEITSIIDVTPIPHNGCRPRKRRRV 126


>gi|171914055|ref|ZP_02929525.1| 30S ribosomal protein S11 [Verrucomicrobium spinosum DSM 4136]
          Length = 190

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 60/128 (46%), Positives = 88/128 (68%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           P++P  I+ +  KN+ SG  HV +TFNNT++++TD +GN I WSS   +GF GSRK + +
Sbjct: 63  PEAPKIIKAKGSKNVSSGIVHVTATFNNTQVSVTDRNGNLIGWSSSGKMGFKGSRKGTAY 122

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           A QV + D   +A  HG+  +EV++ G G+GR+SA+RA++A+   I  I DVT + HNGC
Sbjct: 123 AGQVVSQDACRQAMGHGLREVEVRLKGPGSGRESAVRAVQALNIEITVIKDVTPVPHNGC 182

Query: 122 RPRKRRRI 129
           RP K RR+
Sbjct: 183 RPPKARRV 190


>gi|309777157|ref|ZP_07672120.1| 30S ribosomal protein S11 [Erysipelotrichaceae bacterium 3_1_53]
 gi|308915027|gb|EFP60804.1| 30S ribosomal protein S11 [Erysipelotrichaceae bacterium 3_1_53]
          Length = 132

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 85/126 (67%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K+ +R + + RKNI  G AHV STFNNT +TITD +GN +AWSS   +GF GSRK++PFA
Sbjct: 6   KAGARGKRKARKNIARGVAHVHSTFNNTIVTITDENGNAVAWSSAGALGFKGSRKSTPFA 65

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +     A  +GM  + V V G G GR++A+RAL+  G  I  I DVT I HNGCR
Sbjct: 66  AQMAGEAAGKAAIENGMKVIAVSVKGPGPGREAAVRALQVAGLEITLINDVTPIPHNGCR 125

Query: 123 PRKRRR 128
           P KR R
Sbjct: 126 PPKRPR 131


>gi|311029076|ref|ZP_07707166.1| 30S ribosomal protein S11 [Bacillus sp. m3-13]
          Length = 129

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 87/121 (71%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI  G AH+ STFNNT +TITD HGN I WSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVKKNIEQGIAHIRSTFNNTIVTITDSHGNAIGWSSAGALGFRGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +     HG+ +LEV V G GAGR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TAAKACMEHGLKTLEVTVKGPGAGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|289759622|ref|ZP_06519000.1| LOW QUALITY PROTEIN: 30S ribosomal protein S11 [Mycobacterium
           tuberculosis T85]
 gi|289715186|gb|EFD79198.1| LOW QUALITY PROTEIN: 30S ribosomal protein S11 [Mycobacterium
           tuberculosis T85]
          Length = 126

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 92/124 (74%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
            + R RE+KN+  G AH+ STFNNT +TITDP GN IAW+S   VGF GSRK++PFAAQ+
Sbjct: 3   QKTRRREKKNVPHGAAHIKSTFNNTIVTITDPQGNVIAWASSGHVGFKGSRKSTPFAAQL 62

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A ++ + KAQ+HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNG RP K
Sbjct: 63  AAENAARKAQDHGVRKVDVFVKGPGSGRETAIRSLQAAGLEVGAISDVTPQPHNGVRPPK 122

Query: 126 RRRI 129
           RRR+
Sbjct: 123 RRRV 126


>gi|221632953|ref|YP_002522176.1| 30S ribosomal protein S11 [Thermomicrobium roseum DSM 5159]
 gi|254811053|sp|B9KZW2|RS11_THERP RecName: Full=30S ribosomal protein S11
 gi|221155413|gb|ACM04540.1| ribosomal protein S11 [Thermomicrobium roseum DSM 5159]
          Length = 137

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 88/117 (75%)

Query: 12  ERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCS 71
           ERKNI  GRA++ +TFNNT +T+TDP+GN +AWSS    GF G+RK++P+AAQVA ++ +
Sbjct: 20  ERKNIPRGRAYIHATFNNTIVTLTDPNGNVVAWSSAGSSGFKGTRKSTPYAAQVAAENAA 79

Query: 72  AKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
            KA  HGM  ++V V G GAGR+ A+RAL A G  ++SI D+T + HNGCRP KRRR
Sbjct: 80  RKAMEHGMRQVDVYVKGAGAGREMAIRALAAAGLQVMSITDITPVPHNGCRPPKRRR 136


>gi|145588265|ref|YP_001154862.1| 30S ribosomal protein S11 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|226708398|sp|A4SUY4|RS11_POLSQ RecName: Full=30S ribosomal protein S11
 gi|145046671|gb|ABP33298.1| SSU ribosomal protein S11P [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 135

 Score =  130 bits (327), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 85/123 (69%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R R + +KN+  G AHV ++FNNT ITITD  GN ++W++    GF GSRK++PFAAQVA
Sbjct: 13  RARKKVKKNVADGIAHVHASFNNTIITITDRQGNALSWATSGGQGFKGSRKSTPFAAQVA 72

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +     A   G+ +LEV++ G G GR+SA+RAL ++G  I  I DVT + HNGCRP KR
Sbjct: 73  AEVAGKAAVECGIKNLEVQIKGPGPGRESAVRALNSLGIKITEIQDVTPVPHNGCRPPKR 132

Query: 127 RRI 129
           RRI
Sbjct: 133 RRI 135


>gi|288904298|ref|YP_003429519.1| ribosomal protein S11 [Streptococcus gallolyticus UCN34]
 gi|306830327|ref|ZP_07463498.1| 30S ribosomal protein S11 [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|306832572|ref|ZP_07465712.1| 30S ribosomal protein S11 [Streptococcus bovis ATCC 700338]
 gi|320548030|ref|ZP_08042310.1| 30S ribosomal protein S11 [Streptococcus equinus ATCC 9812]
 gi|325977277|ref|YP_004286993.1| 30S ribosomal protein S11 [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|288731023|emb|CBI12567.1| ribosomal protein S11 [Streptococcus gallolyticus UCN34]
 gi|304425330|gb|EFM28456.1| 30S ribosomal protein S11 [Streptococcus bovis ATCC 700338]
 gi|304427574|gb|EFM30675.1| 30S ribosomal protein S11 [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|320447272|gb|EFW88035.1| 30S ribosomal protein S11 [Streptococcus equinus ATCC 9812]
 gi|325177205|emb|CBZ47249.1| 30S ribosomal protein S11 [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 127

 Score =  130 bits (327), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 71/125 (56%), Positives = 91/125 (72%), Gaps = 1/125 (0%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P+R R R +KNI SG AH+ +TFNNT + ITD HGN IAWSS   +GF GSRK++PFAAQ
Sbjct: 4   PTRKR-RVKKNIESGVAHIHATFNNTIVMITDVHGNAIAWSSAGALGFKGSRKSTPFAAQ 62

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           +A +  +  AQ HG+ ++EV V G G+GR+SA+RAL A G  + SI DVT + HNG RP 
Sbjct: 63  MAAEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLEVTSIRDVTPVPHNGARPP 122

Query: 125 KRRRI 129
           KRRR+
Sbjct: 123 KRRRV 127


>gi|30260327|ref|NP_842704.1| 30S ribosomal protein S11 [Bacillus anthracis str. Ames]
 gi|42779217|ref|NP_976464.1| 30S ribosomal protein S11 [Bacillus cereus ATCC 10987]
 gi|47525392|ref|YP_016741.1| 30S ribosomal protein S11 [Bacillus anthracis str. 'Ames Ancestor']
 gi|47570248|ref|ZP_00240899.1| ribosomal protein S11 [Bacillus cereus G9241]
 gi|49183170|ref|YP_026422.1| 30S ribosomal protein S11 [Bacillus anthracis str. Sterne]
 gi|49481684|ref|YP_034487.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|52145082|ref|YP_081746.1| 30S ribosomal protein S11 [Bacillus cereus E33L]
 gi|118475904|ref|YP_893055.1| 30S ribosomal protein S11 [Bacillus thuringiensis str. Al Hakam]
 gi|167642079|ref|ZP_02400303.1| ribosomal protein S11 [Bacillus anthracis str. A0193]
 gi|177656191|ref|ZP_02937172.1| ribosomal protein S11 [Bacillus anthracis str. A0174]
 gi|190567347|ref|ZP_03020261.1| ribosomal protein S11 [Bacillus anthracis Tsiankovskii-I]
 gi|217957711|ref|YP_002336255.1| 30S ribosomal protein S11 [Bacillus cereus AH187]
 gi|218901341|ref|YP_002449175.1| ribosomal protein S11 [Bacillus cereus AH820]
 gi|222093906|ref|YP_002527956.1| 30S ribosomal protein s11 [Bacillus cereus Q1]
 gi|225862188|ref|YP_002747566.1| 30S ribosomal protein S11 [Bacillus cereus 03BB102]
 gi|227812809|ref|YP_002812818.1| 30S ribosomal protein S11 [Bacillus anthracis str. CDC 684]
 gi|228912875|ref|ZP_04076522.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228925389|ref|ZP_04088485.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228931638|ref|ZP_04094544.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228943941|ref|ZP_04106326.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228983391|ref|ZP_04143604.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229089267|ref|ZP_04220548.1| 30S ribosomal protein S11 [Bacillus cereus Rock3-42]
 gi|229119798|ref|ZP_04249059.1| 30S ribosomal protein S11 [Bacillus cereus 95/8201]
 gi|229136982|ref|ZP_04265609.1| 30S ribosomal protein S11 [Bacillus cereus BDRD-ST26]
 gi|229182530|ref|ZP_04309781.1| 30S ribosomal protein S11 [Bacillus cereus BGSC 6E1]
 gi|229194526|ref|ZP_04321329.1| 30S ribosomal protein S11 [Bacillus cereus m1293]
 gi|229603603|ref|YP_002864787.1| 30S ribosomal protein S11 [Bacillus anthracis str. A0248]
 gi|254686635|ref|ZP_05150494.1| 30S ribosomal protein S11 [Bacillus anthracis str. CNEVA-9066]
 gi|254726285|ref|ZP_05188067.1| 30S ribosomal protein S11 [Bacillus anthracis str. A1055]
 gi|254735290|ref|ZP_05192998.1| 30S ribosomal protein S11 [Bacillus anthracis str. Western North
           America USA6153]
 gi|254739482|ref|ZP_05197180.1| 30S ribosomal protein S11 [Bacillus anthracis str. Kruger B]
 gi|254751246|ref|ZP_05203284.1| 30S ribosomal protein S11 [Bacillus anthracis str. Vollum]
 gi|254756845|ref|ZP_05208873.1| 30S ribosomal protein S11 [Bacillus anthracis str. Australia 94]
 gi|300119551|ref|ZP_07057095.1| 30S ribosomal protein S11 [Bacillus cereus SJ1]
 gi|301051873|ref|YP_003790084.1| 30S ribosomal protein S11 [Bacillus anthracis CI]
 gi|34925199|sp|Q81VQ5|RS11_BACAN RecName: Full=30S ribosomal protein S11
 gi|59798640|sp|Q63H65|RS11_BACCZ RecName: Full=30S ribosomal protein S11
 gi|59798715|sp|Q6HPN3|RS11_BACHK RecName: Full=30S ribosomal protein S11
 gi|59798783|sp|Q73F70|RS11_BACC1 RecName: Full=30S ribosomal protein S11
 gi|152060575|sp|A0R8K5|RS11_BACAH RecName: Full=30S ribosomal protein S11
 gi|226708327|sp|B7JKE6|RS11_BACC0 RecName: Full=30S ribosomal protein S11
 gi|226708330|sp|B7HQX0|RS11_BACC7 RecName: Full=30S ribosomal protein S11
 gi|254765363|sp|C3P9T1|RS11_BACAA RecName: Full=30S ribosomal protein S11
 gi|254765364|sp|C3LJX0|RS11_BACAC RecName: Full=30S ribosomal protein S11
 gi|254765365|sp|C1ET65|RS11_BACC3 RecName: Full=30S ribosomal protein S11
 gi|254765366|sp|B9IZM0|RS11_BACCQ RecName: Full=30S ribosomal protein S11
 gi|30253648|gb|AAP24190.1| 30S ribosomal protein S11 [Bacillus anthracis str. Ames]
 gi|42735132|gb|AAS39072.1| ribosomal protein S11 [Bacillus cereus ATCC 10987]
 gi|47500540|gb|AAT29216.1| ribosomal protein S11 [Bacillus anthracis str. 'Ames Ancestor']
 gi|47553072|gb|EAL11472.1| ribosomal protein S11 [Bacillus cereus G9241]
 gi|49177097|gb|AAT52473.1| ribosomal protein S11 [Bacillus anthracis str. Sterne]
 gi|49333240|gb|AAT63886.1| ribosomal protein S11 (30A ribosomal protein S11) [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|51978551|gb|AAU20101.1| ribosomal protein S11 (30A ribosomal protein S11) [Bacillus cereus
           E33L]
 gi|118415129|gb|ABK83548.1| SSU ribosomal protein S11P [Bacillus thuringiensis str. Al Hakam]
 gi|167509966|gb|EDR85388.1| ribosomal protein S11 [Bacillus anthracis str. A0193]
 gi|172079839|gb|EDT64953.1| ribosomal protein S11 [Bacillus anthracis str. A0174]
 gi|190561474|gb|EDV15445.1| ribosomal protein S11 [Bacillus anthracis Tsiankovskii-I]
 gi|217063612|gb|ACJ77862.1| ribosomal protein S11 [Bacillus cereus AH187]
 gi|218537606|gb|ACK90004.1| ribosomal protein S11 [Bacillus cereus AH820]
 gi|221237954|gb|ACM10664.1| ribosomal protein S11 (30A ribosomal protein S11) [Bacillus cereus
           Q1]
 gi|225790679|gb|ACO30896.1| 30S ribosomal protein S11 [Bacillus cereus 03BB102]
 gi|227005304|gb|ACP15047.1| 30S ribosomal protein S11 [Bacillus anthracis str. CDC 684]
 gi|228588992|gb|EEK47007.1| 30S ribosomal protein S11 [Bacillus cereus m1293]
 gi|228600985|gb|EEK58554.1| 30S ribosomal protein S11 [Bacillus cereus BGSC 6E1]
 gi|228646520|gb|EEL02727.1| 30S ribosomal protein S11 [Bacillus cereus BDRD-ST26]
 gi|228663699|gb|EEL19278.1| 30S ribosomal protein S11 [Bacillus cereus 95/8201]
 gi|228694106|gb|EEL47788.1| 30S ribosomal protein S11 [Bacillus cereus Rock3-42]
 gi|228776381|gb|EEM24734.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228815774|gb|EEM62010.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228828066|gb|EEM73794.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228834311|gb|EEM79852.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228846811|gb|EEM91816.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|229268011|gb|ACQ49648.1| 30S ribosomal protein S11 [Bacillus anthracis str. A0248]
 gi|298723023|gb|EFI63921.1| 30S ribosomal protein S11 [Bacillus cereus SJ1]
 gi|300374042|gb|ADK02946.1| 30S ribosomal protein S11 [Bacillus cereus biovar anthracis str.
           CI]
 gi|324324127|gb|ADY19387.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 129

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT +T+TD HGN ++WSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KKRVKKNIEAGVAHIRSTFNNTIVTLTDTHGNALSWSSAGALGFRGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ +LEV V G GAGR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TAAKAAMEHGLKTLEVTVKGPGAGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|81429353|ref|YP_396354.1| 30S ribosomal protein S11 [Lactobacillus sakei subsp. sakei 23K]
 gi|91207657|sp|Q38UT6|RS11_LACSS RecName: Full=30S ribosomal protein S11
 gi|78610996|emb|CAI56048.1| 30S ribosomal protein S11 [Lactobacillus sakei subsp. sakei 23K]
          Length = 130

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT + ITDP+GN +AWSS   +GF GSRK++PFAAQ+A +
Sbjct: 10  KRRVKKNIEAGVAHIHSTFNNTLVMITDPNGNAVAWSSAGSLGFKGSRKSTPFAAQMAAE 69

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
               +A  HGM S+EV V G G+GR++A+R+L+A G  + +I DVT + HNG RP KRRR
Sbjct: 70  AAGKEAMEHGMKSIEVAVKGPGSGREAAIRSLQATGLEVTAIRDVTPVPHNGSRPPKRRR 129

Query: 129 I 129
           +
Sbjct: 130 V 130


>gi|55821880|ref|YP_140322.1| 30S ribosomal protein S11 [Streptococcus thermophilus LMG 18311]
 gi|55823796|ref|YP_142237.1| 30S ribosomal protein S11 [Streptococcus thermophilus CNRZ1066]
 gi|116628573|ref|YP_821192.1| 30S ribosomal protein S11 [Streptococcus thermophilus LMD-9]
 gi|312862476|ref|ZP_07722719.1| 30S ribosomal protein S11 [Streptococcus vestibularis F0396]
 gi|322374070|ref|ZP_08048604.1| 30S ribosomal protein S11 [Streptococcus sp. C150]
 gi|322515892|ref|ZP_08068834.1| 30S ribosomal protein S11 [Streptococcus vestibularis ATCC 49124]
 gi|81558874|sp|Q5LXT6|RS11_STRT1 RecName: Full=30S ribosomal protein S11
 gi|81560061|sp|Q5M2D8|RS11_STRT2 RecName: Full=30S ribosomal protein S11
 gi|122266833|sp|Q03IH6|RS11_STRTD RecName: Full=30S ribosomal protein S11
 gi|55737865|gb|AAV61507.1| 30S ribosomal protein S11 [Streptococcus thermophilus LMG 18311]
 gi|55739781|gb|AAV63422.1| 30S ribosomal protein S11 [Streptococcus thermophilus CNRZ1066]
 gi|116101850|gb|ABJ66996.1| SSU ribosomal protein S11P [Streptococcus thermophilus LMD-9]
 gi|311102119|gb|EFQ60319.1| 30S ribosomal protein S11 [Streptococcus vestibularis F0396]
 gi|312279234|gb|ADQ63891.1| 30S ribosomal protein S11 [Streptococcus thermophilus ND03]
 gi|321277036|gb|EFX54107.1| 30S ribosomal protein S11 [Streptococcus sp. C150]
 gi|322125679|gb|EFX97006.1| 30S ribosomal protein S11 [Streptococcus vestibularis ATCC 49124]
          Length = 127

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 92/125 (73%), Gaps = 1/125 (0%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P+R R R +KNI SG AH+ +TFNNT + ITD HGN +AWSS   +GF GSRK++PFAAQ
Sbjct: 4   PTRKR-RVKKNIESGIAHIHATFNNTIVMITDVHGNAVAWSSAGALGFKGSRKSTPFAAQ 62

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           +A++  +  AQ HG+ ++EV V G G+GR+SA+RAL A G  + +I DVT + HNG RP 
Sbjct: 63  MASEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLEVTAIRDVTPVPHNGARPP 122

Query: 125 KRRRI 129
           KRRR+
Sbjct: 123 KRRRV 127


>gi|77462282|ref|YP_351786.1| 30S ribosomal protein S11 [Rhodobacter sphaeroides 2.4.1]
 gi|126461158|ref|YP_001042272.1| 30S ribosomal protein S11 [Rhodobacter sphaeroides ATCC 17029]
 gi|221638136|ref|YP_002524398.1| 30S ribosomal protein S11 [Rhodobacter sphaeroides KD131]
 gi|91207676|sp|Q3J5P9|RS11_RHOS4 RecName: Full=30S ribosomal protein S11
 gi|152060815|sp|A3PGN4|RS11_RHOS1 RecName: Full=30S ribosomal protein S11
 gi|254811040|sp|B9KLB4|RS11_RHOSK RecName: Full=30S ribosomal protein S11
 gi|77386700|gb|ABA77885.1| SSU ribosomal protein S11P [Rhodobacter sphaeroides 2.4.1]
 gi|126102822|gb|ABN75500.1| SSU ribosomal protein S11P [Rhodobacter sphaeroides ATCC 17029]
 gi|221158917|gb|ACL99896.1| 30S ribosomal protein S11 [Rhodobacter sphaeroides KD131]
          Length = 129

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 100/129 (77%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  +R++ +ERKNI +G AHV S+FNNT+I I+D  GN I+WSS   +GF GSRK++P
Sbjct: 1   MARDKTRMKRKERKNIAAGVAHVNSSFNNTKILISDVQGNAISWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D + KAQ+HGM ++EV+V G G+GR+SALRAL A G  I SI DVT +AHNG
Sbjct: 61  YAAQMAAEDAAKKAQDHGMKTIEVEVQGPGSGRESALRALAAAGLNITSIRDVTPMAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|41410329|ref|NP_963165.1| 30S ribosomal protein S11 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118462594|ref|YP_883535.1| 30S ribosomal protein S11 [Mycobacterium avium 104]
 gi|254776832|ref|ZP_05218348.1| 30S ribosomal protein S11 [Mycobacterium avium subsp. avium ATCC
           25291]
 gi|59798796|sp|Q73S45|RS11_MYCPA RecName: Full=30S ribosomal protein S11
 gi|152060793|sp|A0QKU7|RS11_MYCA1 RecName: Full=30S ribosomal protein S11
 gi|41399163|gb|AAS06781.1| RpsK [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|118163881|gb|ABK64778.1| ribosomal protein S11 [Mycobacterium avium 104]
          Length = 138

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 91/124 (73%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
            + R RE+KN+  G AH+ STFNNT +TITDP GN IAW+S   VGF GSRK++PFAAQ+
Sbjct: 15  QKTRRREKKNVPHGAAHIKSTFNNTIVTITDPQGNVIAWASSGHVGFKGSRKSTPFAAQL 74

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A ++ + KAQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNG RP K
Sbjct: 75  AAENAARKAQEHGVRKVDVFVKGPGSGRETAIRSLQAAGLEVGAISDVTPQPHNGVRPPK 134

Query: 126 RRRI 129
           RRR+
Sbjct: 135 RRRV 138


>gi|317126888|ref|YP_004093170.1| 30S ribosomal protein S11 [Bacillus cellulosilyticus DSM 2522]
 gi|315471836|gb|ADU28439.1| 30S ribosomal protein S11 [Bacillus cellulosilyticus DSM 2522]
          Length = 130

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 70/128 (54%), Positives = 92/128 (71%), Gaps = 1/128 (0%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK+ +R + R+RKNI SG AH+ STFNNT +TITD  GN I+W+S   +GF GSRK++PF
Sbjct: 4   PKT-TRSKRRQRKNIESGVAHIRSTFNNTIVTITDTSGNAISWASAGALGFKGSRKSTPF 62

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ A +  +  A  HGM  +EV V G GAGR++A+R+L+A G  +  I DVT + HNGC
Sbjct: 63  AAQTAAETAAKAAMEHGMKVVEVSVKGPGAGREAAIRSLQATGLEVNMIKDVTPVPHNGC 122

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 123 RPPKRRRV 130


>gi|313891526|ref|ZP_07825136.1| 30S ribosomal protein S11 [Dialister microaerophilus UPII 345-E]
 gi|313119985|gb|EFR43167.1| 30S ribosomal protein S11 [Dialister microaerophilus UPII 345-E]
          Length = 127

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 70/121 (57%), Positives = 92/121 (76%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + RERK++ +G AH+ STFNNT +TITD +GNTI+W+S   +GF GSRK++PFAAQ+A +
Sbjct: 7   KRRERKHVETGAAHIRSTFNNTIVTITDSNGNTISWASAGELGFRGSRKSTPFAAQMAAE 66

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A +HGM S +V V G GAGR++A+RAL+A G  I SI DVT I HNGCRP KRRR
Sbjct: 67  KAAKVAIDHGMRSADVFVKGPGAGREAAIRALQAAGIEISSIKDVTPIPHNGCRPPKRRR 126

Query: 129 I 129
           +
Sbjct: 127 V 127


>gi|11467400|ref|NP_043257.1| ribosomal protein S11 [Cyanophora paradoxa]
 gi|1350866|sp|P48136|RR11_CYAPA RecName: Full=Cyanelle 30S ribosomal protein S11
 gi|1016201|gb|AAA81288.1| ribosomal protein S11 [Cyanophora paradoxa]
          Length = 130

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 83/119 (69%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           +++KNI  G AH+ STFNNT I+IT P G  IAW+S    GF G+RK +PFAAQ A ++ 
Sbjct: 12  KQKKNIPVGVAHIQSTFNNTIISITSPTGEVIAWASAGSSGFKGARKGTPFAAQTAAENS 71

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + +A   GM  +EV +SG G+GR+ A++AL+A G  I  I D+T + HNGCRP KRRR+
Sbjct: 72  ARQAMEQGMRQIEVIISGPGSGREMAIKALQATGLEISLIRDITPVPHNGCRPPKRRRV 130


>gi|27904919|ref|NP_778045.1| 30S ribosomal protein S11 [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
 gi|29611840|sp|P59484|RS11_BUCBP RecName: Full=30S ribosomal protein S11
 gi|27904317|gb|AAO27150.1| 30S ribosomal protein S11 [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
          Length = 129

 Score =  130 bits (327), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 90/129 (69%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K   R++ R +K I+ G AH+ ++FNNT I+I+D  GN + W++    GF GSRK++P
Sbjct: 1   MVKELIRVKKRVKKQILDGIAHIHASFNNTIISISDKKGNVLGWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   +++G+ +LEV V G G GR+S++R L  IGF I++I DVT I HNG
Sbjct: 61  FAAQVAVERCADIVKSYGIKNLEVMVKGPGPGRESSIRTLNTIGFRIINITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CR  K+RR+
Sbjct: 121 CRSPKKRRV 129


>gi|296875380|ref|ZP_06899454.1| 30S ribosomal protein S11 [Streptococcus parasanguinis ATCC 15912]
 gi|312866976|ref|ZP_07727187.1| 30S ribosomal protein S11 [Streptococcus parasanguinis F0405]
 gi|322390684|ref|ZP_08064198.1| 30S ribosomal protein S11 [Streptococcus parasanguinis ATCC 903]
 gi|296433573|gb|EFH19346.1| 30S ribosomal protein S11 [Streptococcus parasanguinis ATCC 15912]
 gi|311097458|gb|EFQ55691.1| 30S ribosomal protein S11 [Streptococcus parasanguinis F0405]
 gi|321142657|gb|EFX38121.1| 30S ribosomal protein S11 [Streptococcus parasanguinis ATCC 903]
          Length = 127

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 71/125 (56%), Positives = 92/125 (73%), Gaps = 1/125 (0%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P+R R R +KNI SG AH+ +TFNNT + ITD HGN IAWSS   +GF GSRK++PFAAQ
Sbjct: 4   PTRKR-RVKKNIESGIAHIHATFNNTIVMITDVHGNAIAWSSAGALGFKGSRKSTPFAAQ 62

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           +A++  +  AQ HG+ S+EV V G G+GR+SA+RAL A G  + +I DVT + HNG RP 
Sbjct: 63  MASEAAAKAAQEHGLKSVEVTVKGPGSGRESAIRALAAAGLEVTAIRDVTPVPHNGARPP 122

Query: 125 KRRRI 129
           KRRR+
Sbjct: 123 KRRRV 127


>gi|269469224|gb|EEZ80755.1| ribosomal protein S11 [uncultured SUP05 cluster bacterium]
          Length = 127

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 88/129 (68%), Gaps = 2/129 (1%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P  I+ + +K +  G AH+ +TFNNT + ITD HGN + W++    GF GSRK++P
Sbjct: 1   MAKTP--IKKKSKKIVSDGIAHIHATFNNTIVMITDRHGNAVCWATAGGAGFRGSRKSTP 58

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA  +C  KA   GM +L+V+V G G GRDSA+R L A G  I SI DVT I HNG
Sbjct: 59  FAAQVAAGNCGEKALTFGMKNLDVRVKGPGPGRDSAIRGLNAQGLKIQSITDVTPIPHNG 118

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 119 CRPSKKRRV 127


>gi|163840859|ref|YP_001625264.1| 30S ribosomal protein S11 [Renibacterium salmoninarum ATCC 33209]
 gi|189040428|sp|A9WSR2|RS11_RENSM RecName: Full=30S ribosomal protein S11
 gi|162954335|gb|ABY23850.1| SSU ribosomal protein S11P [Renibacterium salmoninarum ATCC 33209]
          Length = 133

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +++KNI  G+AH+ STFNNT +TITDP G  IAW+S   VGF GSRK++PFAAQ+A +
Sbjct: 13  RKKDKKNIALGQAHIKSTFNNTIVTITDPAGAVIAWASSGEVGFKGSRKSTPFAAQLAAE 72

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + +AQ HG+  ++V V G G+GR++A+R+L A G  + SI DVT  AHNGCRP KRRR
Sbjct: 73  QAAKRAQEHGVRKVDVFVKGPGSGRETAIRSLTAAGLEVGSIQDVTPSAHNGCRPPKRRR 132

Query: 129 I 129
           +
Sbjct: 133 V 133


>gi|257784937|ref|YP_003180154.1| 30S ribosomal protein S11 [Atopobium parvulum DSM 20469]
 gi|257473444|gb|ACV51563.1| ribosomal protein S11 [Atopobium parvulum DSM 20469]
          Length = 133

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 66/123 (53%), Positives = 89/123 (72%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R+R  ERKNI  G+AH+ STFNNT ++I+DP GN I+W S   VGF GSRK++PFAAQ+
Sbjct: 10  TRVRRSERKNIAVGQAHIKSTFNNTIVSISDPQGNVISWQSGGTVGFKGSRKSTPFAAQL 69

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  +  A  HG+  + V V G G+GR++A+R+L+A G  +  I D T IAHNGCRP+K
Sbjct: 70  AAEAAAKAAMEHGLHKVAVFVKGPGSGRETAIRSLQAAGLEVSGIQDKTPIAHNGCRPKK 129

Query: 126 RRR 128
           RRR
Sbjct: 130 RRR 132


>gi|218895271|ref|YP_002443682.1| ribosomal protein S11 [Bacillus cereus G9842]
 gi|228898889|ref|ZP_04063171.1| 30S ribosomal protein S11 [Bacillus thuringiensis IBL 4222]
 gi|228905933|ref|ZP_04069830.1| 30S ribosomal protein S11 [Bacillus thuringiensis IBL 200]
 gi|228937439|ref|ZP_04100085.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228963236|ref|ZP_04124405.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228970325|ref|ZP_04130984.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228976895|ref|ZP_04137307.1| 30S ribosomal protein S11 [Bacillus thuringiensis Bt407]
 gi|229015537|ref|ZP_04172534.1| 30S ribosomal protein S11 [Bacillus cereus AH1273]
 gi|229021747|ref|ZP_04178328.1| 30S ribosomal protein S11 [Bacillus cereus AH1272]
 gi|229027984|ref|ZP_04184137.1| 30S ribosomal protein S11 [Bacillus cereus AH1271]
 gi|229074197|ref|ZP_04207243.1| 30S ribosomal protein S11 [Bacillus cereus Rock4-18]
 gi|229094858|ref|ZP_04225863.1| 30S ribosomal protein S11 [Bacillus cereus Rock3-29]
 gi|229100935|ref|ZP_04231739.1| 30S ribosomal protein S11 [Bacillus cereus Rock3-28]
 gi|229113812|ref|ZP_04243247.1| 30S ribosomal protein S11 [Bacillus cereus Rock1-3]
 gi|229170987|ref|ZP_04298588.1| 30S ribosomal protein S11 [Bacillus cereus MM3]
 gi|226708328|sp|B7IT45|RS11_BACC2 RecName: Full=30S ribosomal protein S11
 gi|218541168|gb|ACK93562.1| ribosomal protein S11 [Bacillus cereus G9842]
 gi|228612527|gb|EEK69748.1| 30S ribosomal protein S11 [Bacillus cereus MM3]
 gi|228669683|gb|EEL25090.1| 30S ribosomal protein S11 [Bacillus cereus Rock1-3]
 gi|228682514|gb|EEL36587.1| 30S ribosomal protein S11 [Bacillus cereus Rock3-28]
 gi|228688601|gb|EEL42474.1| 30S ribosomal protein S11 [Bacillus cereus Rock3-29]
 gi|228708967|gb|EEL61094.1| 30S ribosomal protein S11 [Bacillus cereus Rock4-18]
 gi|228733372|gb|EEL84201.1| 30S ribosomal protein S11 [Bacillus cereus AH1271]
 gi|228739556|gb|EEL89971.1| 30S ribosomal protein S11 [Bacillus cereus AH1272]
 gi|228745760|gb|EEL95765.1| 30S ribosomal protein S11 [Bacillus cereus AH1273]
 gi|228782865|gb|EEM31031.1| 30S ribosomal protein S11 [Bacillus thuringiensis Bt407]
 gi|228789434|gb|EEM37354.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228796494|gb|EEM43933.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228822272|gb|EEM68254.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228853748|gb|EEM98508.1| 30S ribosomal protein S11 [Bacillus thuringiensis IBL 200]
 gi|228860789|gb|EEN05167.1| 30S ribosomal protein S11 [Bacillus thuringiensis IBL 4222]
 gi|326937931|gb|AEA13827.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 129

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT +T+TD HGN ++WSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KKRVKKNIEAGIAHIRSTFNNTIVTLTDTHGNALSWSSAGALGFRGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ +LEV V G GAGR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  AAAKVAMEHGLKTLEVTVKGPGAGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|30018405|ref|NP_830036.1| 30S ribosomal protein S11 [Bacillus cereus ATCC 14579]
 gi|206972246|ref|ZP_03233193.1| 30S ribosomal protein S11 [Bacillus cereus AH1134]
 gi|218231984|ref|YP_002364985.1| 30S ribosomal protein S11 [Bacillus cereus B4264]
 gi|228919086|ref|ZP_04082465.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228950684|ref|ZP_04112818.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228956577|ref|ZP_04118373.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|229041041|ref|ZP_04189804.1| 30S ribosomal protein S11 [Bacillus cereus AH676]
 gi|229067901|ref|ZP_04201218.1| 30S ribosomal protein S11 [Bacillus cereus F65185]
 gi|229077436|ref|ZP_04210087.1| 30S ribosomal protein S11 [Bacillus cereus Rock4-2]
 gi|229107822|ref|ZP_04237458.1| 30S ribosomal protein S11 [Bacillus cereus Rock1-15]
 gi|229125653|ref|ZP_04254685.1| 30S ribosomal protein S11 [Bacillus cereus BDRD-Cer4]
 gi|229142942|ref|ZP_04271383.1| 30S ribosomal protein S11 [Bacillus cereus BDRD-ST24]
 gi|229148545|ref|ZP_04276801.1| 30S ribosomal protein S11 [Bacillus cereus m1550]
 gi|229159309|ref|ZP_04287333.1| 30S ribosomal protein S11 [Bacillus cereus R309803]
 gi|229176736|ref|ZP_04304140.1| 30S ribosomal protein S11 [Bacillus cereus 172560W]
 gi|229188421|ref|ZP_04315469.1| 30S ribosomal protein S11 [Bacillus cereus ATCC 10876]
 gi|296500969|ref|YP_003662669.1| 30S ribosomal protein S11 [Bacillus thuringiensis BMB171]
 gi|34925196|sp|Q81J19|RS11_BACCR RecName: Full=30S ribosomal protein S11
 gi|226708329|sp|B7HJ74|RS11_BACC4 RecName: Full=30S ribosomal protein S11
 gi|29893945|gb|AAP07237.1| SSU ribosomal protein S11P [Bacillus cereus ATCC 14579]
 gi|206732820|gb|EDZ49995.1| 30S ribosomal protein S11 [Bacillus cereus AH1134]
 gi|218159941|gb|ACK59933.1| ribosomal protein S11 [Bacillus cereus B4264]
 gi|228595095|gb|EEK52866.1| 30S ribosomal protein S11 [Bacillus cereus ATCC 10876]
 gi|228606779|gb|EEK64196.1| 30S ribosomal protein S11 [Bacillus cereus 172560W]
 gi|228624201|gb|EEK81003.1| 30S ribosomal protein S11 [Bacillus cereus R309803]
 gi|228634961|gb|EEK91534.1| 30S ribosomal protein S11 [Bacillus cereus m1550]
 gi|228640563|gb|EEK96952.1| 30S ribosomal protein S11 [Bacillus cereus BDRD-ST24]
 gi|228657845|gb|EEL13651.1| 30S ribosomal protein S11 [Bacillus cereus BDRD-Cer4]
 gi|228675671|gb|EEL30879.1| 30S ribosomal protein S11 [Bacillus cereus Rock1-15]
 gi|228705886|gb|EEL58221.1| 30S ribosomal protein S11 [Bacillus cereus Rock4-2]
 gi|228715260|gb|EEL67119.1| 30S ribosomal protein S11 [Bacillus cereus F65185]
 gi|228727338|gb|EEL78532.1| 30S ribosomal protein S11 [Bacillus cereus AH676]
 gi|228803142|gb|EEM49964.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228809035|gb|EEM55520.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228840611|gb|EEM85873.1| 30S ribosomal protein S11 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|296322021|gb|ADH04949.1| 30S ribosomal protein S11 [Bacillus thuringiensis BMB171]
          Length = 129

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT +T+TD HGN ++WSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KKRVKKNIEAGIAHIRSTFNNTIVTLTDTHGNALSWSSAGALGFRGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ +LEV V G GAGR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TAAKAAMEHGLKTLEVTVKGPGAGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|184155966|ref|YP_001844306.1| 30S ribosomal protein S11 [Lactobacillus fermentum IFO 3956]
 gi|227515512|ref|ZP_03945561.1| ribosomal protein S11 [Lactobacillus fermentum ATCC 14931]
 gi|260662777|ref|ZP_05863671.1| 30S ribosomal protein S11 [Lactobacillus fermentum 28-3-CHN]
 gi|226708380|sp|B2GDU4|RS11_LACF3 RecName: Full=30S ribosomal protein S11
 gi|183227310|dbj|BAG27826.1| 30S ribosomal protein S11 [Lactobacillus fermentum IFO 3956]
 gi|227086125|gb|EEI21437.1| ribosomal protein S11 [Lactobacillus fermentum ATCC 14931]
 gi|260552858|gb|EEX25857.1| 30S ribosomal protein S11 [Lactobacillus fermentum 28-3-CHN]
          Length = 129

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT I ITD  GN +AWSS  V+GF GSRK++PFAAQ+A++
Sbjct: 9   KRRVKKNIETGVAHIHSTFNNTLIMITDVQGNAVAWSSAGVLGFKGSRKSTPFAAQMASE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + +A  HGM ++EV+V G G+GR+SA+RAL+  G  + +I DVT + HNG RP KRRR
Sbjct: 69  AAAKQAMEHGMKTVEVEVKGPGSGRESAIRALQTTGLEVTAIRDVTPVPHNGSRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|169830006|ref|YP_001700164.1| 30S ribosomal protein S11 [Lysinibacillus sphaericus C3-41]
 gi|299541957|ref|ZP_07052280.1| 30S ribosomal protein S11 [Lysinibacillus fusiformis ZC1]
 gi|226708383|sp|B1HMV6|RS11_LYSSC RecName: Full=30S ribosomal protein S11
 gi|168994494|gb|ACA42034.1| 30S ribosomal protein S11 (BS11) [Lysinibacillus sphaericus C3-41]
 gi|298725695|gb|EFI66336.1| 30S ribosomal protein S11 [Lysinibacillus fusiformis ZC1]
          Length = 129

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI SG AH+ STFNNT +TITD  GN ++WSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVKKNIESGIAHIRSTFNNTIVTITDMQGNAVSWSSAGALGFRGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  +  HG+ +LEV V G GAGR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TAAKTSLEHGLKTLEVTVKGPGAGREAAIRALQAAGLEVTAIKDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|154684660|ref|YP_001419821.1| 30S ribosomal protein S11 [Bacillus amyloliquefaciens FZB42]
 gi|166231799|sp|A7Z0R4|RS11_BACA2 RecName: Full=30S ribosomal protein S11
 gi|154350511|gb|ABS72590.1| RpsK [Bacillus amyloliquefaciens FZB42]
          Length = 131

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI SG AH+ STFNNT +TITD HGN ++WSS   +GF GSRK++PFAAQ+A +
Sbjct: 11  KRRVKKNIESGIAHIRSTFNNTIVTITDTHGNALSWSSAGALGFRGSRKSTPFAAQMAAE 70

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  +  HG+ +LEV V G G+GR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 71  TAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRR 130

Query: 129 I 129
           +
Sbjct: 131 V 131


>gi|302336355|ref|YP_003801562.1| SSU ribosomal protein S11P [Olsenella uli DSM 7084]
 gi|301320195|gb|ADK68682.1| SSU ribosomal protein S11P [Olsenella uli DSM 7084]
          Length = 133

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 70/121 (57%), Positives = 88/121 (72%)

Query: 8   IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
           +R  ERKNI  G+AH+ STFNNT I+ITDP GN IAW S   VGF GSRK++PFAAQVA 
Sbjct: 12  VRRAERKNIAVGQAHIKSTFNNTIISITDPQGNVIAWQSGGTVGFKGSRKSTPFAAQVAA 71

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
           + C+  A  HG+  + V V G G+GR++A+R+L+A G  +  I D T IAHNGCRP+KRR
Sbjct: 72  EACAKAAMEHGLHKVVVFVKGPGSGRETAVRSLQAAGLEVSGIQDKTPIAHNGCRPKKRR 131

Query: 128 R 128
           R
Sbjct: 132 R 132


>gi|146278545|ref|YP_001168704.1| 30S ribosomal protein S11 [Rhodobacter sphaeroides ATCC 17025]
 gi|166231826|sp|A4WVI5|RS11_RHOS5 RecName: Full=30S ribosomal protein S11
 gi|145556786|gb|ABP71399.1| SSU ribosomal protein S11P [Rhodobacter sphaeroides ATCC 17025]
          Length = 129

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 99/129 (76%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +  +R++ +ERKNI +G AHV S+FNNT+I I+D  GN I+WSS   +GF GSRK++P
Sbjct: 1   MARDKTRMKRKERKNIAAGVAHVNSSFNNTKILISDVQGNAISWSSAGTMGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +D + KAQ HGM ++EV+V G G+GR+SALRAL A G  I SI DVT +AHNG
Sbjct: 61  YAAQMAAEDAAKKAQEHGMKTIEVEVQGPGSGRESALRALAAAGLNITSIRDVTPMAHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|210631178|ref|ZP_03296789.1| hypothetical protein COLSTE_00674 [Collinsella stercoris DSM 13279]
 gi|210160145|gb|EEA91116.1| hypothetical protein COLSTE_00674 [Collinsella stercoris DSM 13279]
          Length = 135

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 69/124 (55%), Positives = 91/124 (73%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +RI+  +RKNI  G+AH+ STFNNT ++ITDP GN IAW S   VGF GSRK++PFAAQ+
Sbjct: 12  TRIKRADRKNISVGQAHIRSTFNNTIVSITDPAGNVIAWQSAGTVGFKGSRKSTPFAAQM 71

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A + C+  A  HGM  + V V G G+GR++A+R+L+A G  + SI D T I HNGCRP+K
Sbjct: 72  AAEACAKAAMEHGMHKVAVFVKGPGSGRETAIRSLQAAGLEVSSIQDKTPIPHNGCRPKK 131

Query: 126 RRRI 129
           RRR+
Sbjct: 132 RRRV 135


>gi|91774659|ref|YP_544415.1| 30S ribosomal protein S11 [Methylobacillus flagellatus KT]
 gi|253998039|ref|YP_003050102.1| 30S ribosomal protein S11 [Methylovorus sp. SIP3-4]
 gi|313200104|ref|YP_004038762.1| 30S ribosomal protein S11 [Methylovorus sp. MP688]
 gi|123078969|sp|Q1H4L3|RS11_METFK RecName: Full=30S ribosomal protein S11
 gi|91708646|gb|ABE48574.1| SSU ribosomal protein S11P [Methylobacillus flagellatus KT]
 gi|253984718|gb|ACT49575.1| ribosomal protein S11 [Methylovorus sp. SIP3-4]
 gi|312439420|gb|ADQ83526.1| ribosomal protein S11 [Methylovorus sp. MP688]
          Length = 129

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 92/129 (71%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+  R+R + +KNI  G AHV ++FNNT ITITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKANVRVRKKVKKNIAEGIAHVHASFNNTIITITDRQGNALSWATSGGAGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     AQ  G+ +LEV++ G G GR+SA+RAL A+GF I SI DVT + HNG
Sbjct: 61  FAAQVAAEAAGKAAQECGVKNLEVRIKGPGPGRESAVRALNAVGFKITSISDVTPVPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RRI
Sbjct: 121 CRPPKKRRI 129


>gi|241834460|ref|XP_002414992.1| 40S ribosomal protein S14, putative [Ixodes scapularis]
 gi|215509204|gb|EEC18657.1| 40S ribosomal protein S14, putative [Ixodes scapularis]
          Length = 133

 Score =  130 bits (326), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 84/117 (71%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +K++  G AHV ++FNNT ITITD  GN ++W++    GF GSRK++PFAAQVA +    
Sbjct: 17  KKSVSDGIAHVHASFNNTIITITDRQGNALSWATSGGAGFKGSRKSTPFAAQVAAETAGR 76

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            A  +G+ +LEV++ G G GR+S++RAL A+G  I SI D+T + HNGCRP KRRRI
Sbjct: 77  TAMEYGIKNLEVRIKGPGPGRESSVRALNALGIKITSIADITPVPHNGCRPPKRRRI 133


>gi|296333139|ref|ZP_06875593.1| 30S ribosomal protein S11 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305672842|ref|YP_003864513.1| 30S ribosomal protein S11 [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|296149755|gb|EFG90650.1| 30S ribosomal protein S11 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305411085|gb|ADM36203.1| 30S ribosomal protein S11 [Bacillus subtilis subsp. spizizenii str.
           W23]
          Length = 131

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 94/127 (74%), Gaps = 1/127 (0%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           KS +R R R +KN+ SG AH+ STFNNT +TITD HGN ++WSS   +GF GSRK++PFA
Sbjct: 6   KSNTRKR-RVKKNVESGIAHIRSTFNNTIVTITDTHGNALSWSSAGALGFRGSRKSTPFA 64

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  +  +  HG+ +LEV V G G+GR++A+RAL+A G  + +I DVT + HNGCR
Sbjct: 65  AQMAAETAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQAAGLEVTAIRDVTPVPHNGCR 124

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 125 PPKRRRV 131


>gi|255020790|ref|ZP_05292848.1| SSU ribosomal protein S11p (S14e) [Acidithiobacillus caldus ATCC
           51756]
 gi|254969786|gb|EET27290.1| SSU ribosomal protein S11p (S14e) [Acidithiobacillus caldus ATCC
           51756]
          Length = 132

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 92/123 (74%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R+R + +KN+V G AH+ ++FNNT ITI+D  GN +AW+S    GF GSRK++PFAAQVA
Sbjct: 10  RVRKKIKKNVVDGVAHIYASFNNTIITISDRQGNALAWASSGGSGFRGSRKSTPFAAQVA 69

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            ++   KAQ +G+ +L+V+V G G GR+S +RAL ++GF I SI DVT I HNGCRP K+
Sbjct: 70  AENAGRKAQEYGVKNLDVEVRGPGPGRESTVRALHSVGFRITSIRDVTPIPHNGCRPPKK 129

Query: 127 RRI 129
           RR+
Sbjct: 130 RRV 132


>gi|256390171|ref|YP_003111735.1| 30S ribosomal protein S11 [Catenulispora acidiphila DSM 44928]
 gi|256356397|gb|ACU69894.1| ribosomal protein S11 [Catenulispora acidiphila DSM 44928]
          Length = 136

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 89/123 (72%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +E+KN+  G AH+ STFNNT ++ITDP GN IAW+S   VGF GSRK++PFAAQ+ 
Sbjct: 14  KLRRKEKKNVAHGHAHIKSTFNNTIVSITDPQGNVIAWASSGQVGFKGSRKSTPFAAQMT 73

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +A  HGM  ++V V G G+GR++A+R+L+  G  + SI DVT   HNGCRP KR
Sbjct: 74  AEAAARRAMEHGMKKVDVFVKGPGSGRETAIRSLQQTGLEVGSINDVTPSPHNGCRPPKR 133

Query: 127 RRI 129
           RR+
Sbjct: 134 RRV 136


>gi|302669989|ref|YP_003829949.1| ribosomal protein S11 RpsK [Butyrivibrio proteoclasticus B316]
 gi|302394462|gb|ADL33367.1| ribosomal protein S11 RpsK [Butyrivibrio proteoclasticus B316]
          Length = 135

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 85/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GSRK++P+AAQVA +  +  A
Sbjct: 21  NVEHGQAHIQSSFNNTIVTLTDAAGNALSWASAGGLGFKGSRKSTPYAAQVAAETATKAA 80

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ +++V V G G+GR++A+RAL A G T+ SI DVT + HNGCRP KRRR+
Sbjct: 81  LIHGLKTVDVFVKGPGSGREAAIRALAASGLTVTSITDVTPVPHNGCRPPKRRRV 135


>gi|256826598|ref|YP_003150557.1| 30S ribosomal protein S11P [Cryptobacterium curtum DSM 15641]
 gi|256582741|gb|ACU93875.1| SSU ribosomal protein S11P [Cryptobacterium curtum DSM 15641]
          Length = 132

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 88/124 (70%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +RI+  ERKNI  G AH+ STFNNT ++ITDP GN I+W S   VGF GSRK++PFAAQ+
Sbjct: 9   TRIKRSERKNITVGAAHIKSTFNNTIVSITDPQGNVISWQSAGTVGFKGSRKSTPFAAQM 68

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  +  A  HG+  + V V G G+GR++A+R+L+A G  + SI D T I HNGCRP K
Sbjct: 69  AAEAAAKTAMEHGVKKISVFVKGPGSGRETAIRSLQAAGLEVASIQDCTPIPHNGCRPAK 128

Query: 126 RRRI 129
           RRR+
Sbjct: 129 RRRV 132


>gi|323144987|ref|ZP_08079547.1| 30S ribosomal protein S11 [Succinatimonas hippei YIT 12066]
 gi|322415266|gb|EFY06040.1| 30S ribosomal protein S11 [Succinatimonas hippei YIT 12066]
          Length = 157

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 85/119 (71%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           R +K I  G AH+ ++FNNT +TI+D  GN ++W++    GF GSRK++P+AAQVA +  
Sbjct: 39  RAKKQIADGVAHIHASFNNTIVTISDRQGNALSWATAGGSGFRGSRKSTPYAAQVAAERA 98

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
              A+ +G+ +LEV V G G GR+S++RAL AIG+ I +I DVT I HNGCRP K+RR+
Sbjct: 99  GEAAKEYGVKNLEVLVKGPGPGRESSIRALNAIGYKITNITDVTPIPHNGCRPPKKRRV 157


>gi|293364323|ref|ZP_06611049.1| 30S ribosomal protein S11 [Streptococcus oralis ATCC 35037]
 gi|298502048|ref|YP_003723988.1| 30S ribosomal protein S11 [Streptococcus pneumoniae TCH8431/19A]
 gi|291317169|gb|EFE57596.1| 30S ribosomal protein S11 [Streptococcus oralis ATCC 35037]
 gi|298237643|gb|ADI68774.1| 30S ribosomal protein S11 [Streptococcus pneumoniae TCH8431/19A]
          Length = 118

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 87/117 (74%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KNI SG AH+ +TFNNT + ITD HGN IAWSS   +GF GSRK++PFAAQ+A++  + 
Sbjct: 2   KKNIESGIAHIHATFNNTIVMITDVHGNAIAWSSAGALGFKGSRKSTPFAAQMASEAAAK 61

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            AQ HG+ S+EV V G G+GR+SA+RAL A G  + +I DVT + HNG RP KRRR+
Sbjct: 62  SAQEHGLKSVEVTVKGPGSGRESAIRALAAAGLEVTAIRDVTPVPHNGARPPKRRRV 118


>gi|251772516|gb|EES53082.1| ribosomal protein S11 [Leptospirillum ferrodiazotrophum]
          Length = 128

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 84/121 (69%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + RE+KNI  G  H+ ++FNNT I+I+D  G+ IAWSS     F GSRK++PFAAQ A +
Sbjct: 8   KRREKKNIPVGIVHIHASFNNTIISISDSKGDVIAWSSSGAQSFKGSRKSTPFAAQKAAE 67

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             S KA + GM + EV V G G+GR+SA+RAL+ +G  I  I DVT I HNGCRP KRRR
Sbjct: 68  IASKKAADMGMKACEVYVKGPGSGRESAIRALQTVGIKISLIKDVTPIPHNGCRPPKRRR 127

Query: 129 I 129
           +
Sbjct: 128 V 128


>gi|149197865|ref|ZP_01874914.1| 30S ribosomal protein S11 [Lentisphaera araneosa HTCC2155]
 gi|149139086|gb|EDM27490.1| 30S ribosomal protein S11 [Lentisphaera araneosa HTCC2155]
          Length = 144

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 85/121 (70%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R   N+ +G  HVV+TFNNT+++++D HGN +AWSS   +GF GSRK++ +AAQ+   
Sbjct: 24  KGRTPVNVTNGIVHVVATFNNTKVSVSDVHGNVLAWSSAGKMGFKGSRKSTAYAAQLVAT 83

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           + + +A  +GM  +EV+V G GAGR+SA+R + A G  I  I DVT I HNGCRP KRRR
Sbjct: 84  EAAKRAMTYGMREVEVRVKGPGAGRESAVRGVSAAGLDISLIKDVTPIPHNGCRPPKRRR 143

Query: 129 I 129
           +
Sbjct: 144 V 144


>gi|282882492|ref|ZP_06291113.1| 30S ribosomal protein S11 [Peptoniphilus lacrimalis 315-B]
 gi|300814609|ref|ZP_07094860.1| 30S ribosomal protein S11 [Peptoniphilus sp. oral taxon 836 str.
           F0141]
 gi|281297634|gb|EFA90109.1| 30S ribosomal protein S11 [Peptoniphilus lacrimalis 315-B]
 gi|300511228|gb|EFK38477.1| 30S ribosomal protein S11 [Peptoniphilus sp. oral taxon 836 str.
           F0141]
          Length = 131

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 93/124 (75%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R++ R RKNI  G+AH+ STFNNT +T+TD +GN I+W+S   +GF GSRK++PFAAQ 
Sbjct: 8   TRVKRRARKNIEKGQAHIASTFNNTMVTLTDTNGNVISWASAGQLGFRGSRKSTPFAAQE 67

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A  + + KA+ HG+ S++V V G G+GR++A+R+L+A G  +  I DVT I HNGCRP K
Sbjct: 68  AAAEAANKAKEHGLKSVDVYVKGPGSGREAAIRSLQASGLEVTMIKDVTPIPHNGCRPPK 127

Query: 126 RRRI 129
           RRR+
Sbjct: 128 RRRV 131


>gi|83591249|ref|YP_431258.1| 30S ribosomal protein S11 [Moorella thermoacetica ATCC 39073]
 gi|123739204|sp|Q2RFS4|RS11_MOOTA RecName: Full=30S ribosomal protein S11
 gi|83574163|gb|ABC20715.1| SSU ribosomal protein S11P [Moorella thermoacetica ATCC 39073]
          Length = 130

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 69/128 (53%), Positives = 93/128 (72%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           P+  +R R R+RK+I SG AH+ STFNNT +TITD +GN I+W+S   VGF GSRK++PF
Sbjct: 3   PRKTARPRRRDRKHIESGIAHIKSTFNNTLVTITDKNGNAISWASAGTVGFKGSRKSTPF 62

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ+A +  + +A  HG+  +E  V G GAGR++A+R+L+A G  +  I DVT I HNGC
Sbjct: 63  AAQMAAEAAAKQAMEHGLREVECYVKGPGAGREAAIRSLQAAGLEVSVIKDVTPIPHNGC 122

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 123 RPPKRRRV 130


>gi|150392133|ref|YP_001322182.1| 30S ribosomal protein S11 [Alkaliphilus metalliredigens QYMF]
 gi|171460827|sp|A6TWF5|RS11_ALKMQ RecName: Full=30S ribosomal protein S11
 gi|149951995|gb|ABR50523.1| ribosomal protein S11 [Alkaliphilus metalliredigens QYMF]
          Length = 132

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 87/121 (71%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R ++RKNI  G+AH+ STFNN+ +T+TD  GNTI WS    +GF GSRK++PFAAQ+  +
Sbjct: 12  RKKDRKNIERGQAHIQSTFNNSIVTLTDMQGNTIGWSCAGQLGFKGSRKSTPFAAQMCAE 71

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ ++EV V G GAGR++A+RAL+A G  +  I DVT I HNGCRP KRRR
Sbjct: 72  AAAKSAMEHGLKTIEVFVKGPGAGREAAIRALQAAGLEVSLIKDVTPIPHNGCRPPKRRR 131

Query: 129 I 129
           +
Sbjct: 132 V 132


>gi|311896537|dbj|BAJ28945.1| putative ribosomal protein S11 [Kitasatospora setae KM-6054]
          Length = 135

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 92/123 (74%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           +IR +E+KN+  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++PFAAQ+A
Sbjct: 13  KIRRKEKKNVAHGHAHIKSTFNNTIVSITDPSGNVISWASAGHVGFKGSRKSTPFAAQMA 72

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +AQ HGM  ++V V G G+GR++A+R+L+A G  + SI DVT   HNGCRP KR
Sbjct: 73  AEAAARRAQEHGMRKVDVFVKGPGSGRETAIRSLQATGLEVGSIQDVTPTPHNGCRPPKR 132

Query: 127 RRI 129
           RR+
Sbjct: 133 RRV 135


>gi|45644719|gb|AAS73107.1| predicted ribosomal protein S11 [uncultured marine gamma
           proteobacterium EBAC20E09]
          Length = 125

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 63/111 (56%), Positives = 79/111 (71%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G AH+ S+FNNT +TITD  GNTI W++    GF GSRK++PFAAQ+A D     A+  G
Sbjct: 15  GVAHIHSSFNNTIVTITDKQGNTICWATSGGSGFKGSRKSTPFAAQIAADKAGNAAKEFG 74

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           M +L+VKV G G GR+SA+RAL A G  I SI DVT + HNGCRP K+RR+
Sbjct: 75  MVNLDVKVKGPGGGRESAIRALNACGLKIKSITDVTPLPHNGCRPSKKRRV 125


>gi|24380344|ref|NP_722299.1| 30S ribosomal protein S11 [Streptococcus mutans UA159]
 gi|290581265|ref|YP_003485657.1| 30S ribosomal protein S11 [Streptococcus mutans NN2025]
 gi|48474764|sp|P59378|RS11_STRMU RecName: Full=30S ribosomal protein S11
 gi|24378362|gb|AAN59605.1|AE015023_6 30S ribosomal protein S11 [Streptococcus mutans UA159]
 gi|254998164|dbj|BAH88765.1| 30S ribosomal protein S11 [Streptococcus mutans NN2025]
          Length = 127

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 91/125 (72%), Gaps = 1/125 (0%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P+R R R +KNI SG AH+ +TFNNT + ITD HGN +AWSS   +GF GSRK++PFAAQ
Sbjct: 4   PTRKR-RVKKNIESGIAHIHATFNNTIVMITDVHGNALAWSSAGALGFKGSRKSTPFAAQ 62

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           +A +  +  AQ HG+ ++EV V G G+GR+SA+RAL A G  + SI DVT + HNG RP 
Sbjct: 63  MAAEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLEVTSIRDVTPVPHNGARPP 122

Query: 125 KRRRI 129
           KRRR+
Sbjct: 123 KRRRV 127


>gi|125975411|ref|YP_001039321.1| 30S ribosomal protein S11 [Clostridium thermocellum ATCC 27405]
 gi|256005302|ref|ZP_05430268.1| ribosomal protein S11 [Clostridium thermocellum DSM 2360]
 gi|281419373|ref|ZP_06250388.1| 30S ribosomal protein S11 [Clostridium thermocellum JW20]
 gi|152060585|sp|A3DJJ9|RS11_CLOTH RecName: Full=30S ribosomal protein S11
 gi|125715636|gb|ABN54128.1| SSU ribosomal protein S11P [Clostridium thermocellum ATCC 27405]
 gi|255990738|gb|EEU00854.1| ribosomal protein S11 [Clostridium thermocellum DSM 2360]
 gi|281406993|gb|EFB37256.1| 30S ribosomal protein S11 [Clostridium thermocellum JW20]
 gi|316939527|gb|ADU73561.1| 30S ribosomal protein S11 [Clostridium thermocellum DSM 1313]
          Length = 134

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + +ERKNI  G AH+ STFNNT +TITD  GNTI+WSS   +GF GSRK++PFAAQ+A +
Sbjct: 14  KRKERKNIERGAAHIRSTFNNTIVTITDVEGNTISWSSAGTLGFRGSRKSTPFAAQMAAE 73

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ ++EV V G G+GR++A+RAL+A G  +  I DVT I HNGCRP KRRR
Sbjct: 74  AAAKAAMEHGLKTVEVYVKGPGSGREAAIRALQAAGLEVSLIKDVTPIPHNGCRPPKRRR 133

Query: 129 I 129
           +
Sbjct: 134 V 134


>gi|260438190|ref|ZP_05792006.1| 30S ribosomal protein S11 [Butyrivibrio crossotus DSM 2876]
 gi|292809380|gb|EFF68585.1| 30S ribosomal protein S11 [Butyrivibrio crossotus DSM 2876]
          Length = 130

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 85/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G+AH+ S+FNNT +TITD  GN ++W+S   +GF GSRK++P+AAQ+A +  +  A
Sbjct: 16  NVERGQAHIQSSFNNTIVTITDTEGNALSWASAGGLGFRGSRKSTPYAAQMAAETATKAA 75

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ S++V V G G+GR++A+RAL+A G  + SI DVT + HNGCRP KRRR+
Sbjct: 76  LIHGLKSVDVMVKGPGSGREAAIRALQACGLEVTSIKDVTPVPHNGCRPPKRRRV 130


>gi|293375415|ref|ZP_06621696.1| 30S ribosomal protein S11 [Turicibacter sanguinis PC909]
 gi|325844448|ref|ZP_08168175.1| 30S ribosomal protein S11 [Turicibacter sp. HGF1]
 gi|292645968|gb|EFF63997.1| 30S ribosomal protein S11 [Turicibacter sanguinis PC909]
 gi|325489122|gb|EGC91506.1| 30S ribosomal protein S11 [Turicibacter sp. HGF1]
          Length = 129

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 89/120 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT +TITDPHGN I+WSS   +GF GSRK++PFAAQ+A++
Sbjct: 9   KRRVKKNIATGVAHIHSTFNNTIVTITDPHGNAISWSSAGALGFKGSRKSTPFAAQMASE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A +HGM S++V V G G GR++A+RAL+A G  + +I DVT + HNGCRP K  R
Sbjct: 69  AAAKAAMDHGMKSVDVTVKGPGPGREAAIRALQAAGLDVTAIKDVTPVPHNGCRPPKHPR 128


>gi|331699147|ref|YP_004335386.1| 30S ribosomal protein S11 [Pseudonocardia dioxanivorans CB1190]
 gi|326953836|gb|AEA27533.1| 30S ribosomal protein S11 [Pseudonocardia dioxanivorans CB1190]
          Length = 135

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 66/125 (52%), Positives = 92/125 (73%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P ++R +E+KN+  G AH+ STFNNT ++ITDP G  IAW+S   VGF GSRK++PFAAQ
Sbjct: 11  PKKVRRKEKKNVAHGHAHIKSTFNNTIVSITDPTGAVIAWASAGHVGFKGSRKSTPFAAQ 70

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           +A ++ + KA  HGM  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGCRP 
Sbjct: 71  MAAENAARKAAEHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVGTISDVTPQPHNGCRPP 130

Query: 125 KRRRI 129
           KRRR+
Sbjct: 131 KRRRV 135


>gi|324999250|ref|ZP_08120362.1| 30S ribosomal protein S11 [Pseudonocardia sp. P1]
          Length = 135

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 66/125 (52%), Positives = 90/125 (72%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P ++R RE+KN+  G AH+ STFNNT ++ITDP G  IAW+S   VG  GSRK++PFAAQ
Sbjct: 11  PKKVRRREKKNVAHGHAHIKSTFNNTIVSITDPTGAVIAWASSGHVGLKGSRKSTPFAAQ 70

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           +A ++ + KA  HGM   +V V G G+GR++A+R+L+A G  + +I DVT   HNGCRP 
Sbjct: 71  LAAENAARKAMEHGMKKCDVFVKGPGSGRETAIRSLQAAGLEVGTINDVTPQPHNGCRPP 130

Query: 125 KRRRI 129
           KRRR+
Sbjct: 131 KRRRV 135


>gi|158334433|ref|YP_001515605.1| 30S ribosomal protein S11 [Acaryochloris marina MBIC11017]
 gi|189040399|sp|B0C431|RS11_ACAM1 RecName: Full=30S ribosomal protein S11
 gi|158304674|gb|ABW26291.1| 30S ribosomal protein S11 [Acaryochloris marina MBIC11017]
          Length = 130

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 59/119 (49%), Positives = 86/119 (72%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           +++K++ +G AH+ STFNNT +TI+D  G+ ++W+S    GF G++K +PFAAQ A++  
Sbjct: 12  KQKKHVPNGVAHIQSTFNNTIVTISDASGDVVSWASAGSSGFKGAKKGTPFAAQTASESA 71

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + +A + GM  +EV VSG GAGR++A+RAL+  G  I  I DVT I HNGCRP KRRR+
Sbjct: 72  ARRAMDQGMRQIEVMVSGPGAGRETAIRALQGAGLEITLIRDVTPIPHNGCRPPKRRRV 130


>gi|258646026|ref|ZP_05733495.1| 30S ribosomal protein S11 [Dialister invisus DSM 15470]
 gi|260403398|gb|EEW96945.1| 30S ribosomal protein S11 [Dialister invisus DSM 15470]
          Length = 129

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 94/129 (72%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M    S+ + +ERK++ SG AH+ STFNNT +TITD +GNTIAW+S   +GF GSRK++P
Sbjct: 1   MATVKSKAKRKERKHVESGAAHIRSTFNNTIVTITDSNGNTIAWASAGGLGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  +  A + GM S +V V G GAGR++A+RAL+A G  + SI DVT I HNG
Sbjct: 61  FAAQMAAEQAARAAIDQGMRSADVFVKGPGAGREAAIRALQAAGIEVSSIKDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|239623373|ref|ZP_04666404.1| ribosomal protein S11 [Clostridiales bacterium 1_7_47_FAA]
 gi|239522339|gb|EEQ62205.1| ribosomal protein S11 [Clostridiales bacterium 1_7_47FAA]
          Length = 133

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 85/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GSRK++P+AAQ+A +  +  A
Sbjct: 19  NVERGQAHIQSSFNNTIVTLTDAQGNALSWASAGGLGFRGSRKSTPYAAQMAAETATKAA 78

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ S++V V G G+GR++A+RAL+A G  + SI DVT + HNGCRP KRRR+
Sbjct: 79  LVHGLKSVDVMVKGPGSGREAAIRALQACGLEVTSIKDVTPVPHNGCRPPKRRRV 133


>gi|226939210|ref|YP_002794281.1| 30S ribosomal protein S11 [Laribacter hongkongensis HLHK9]
 gi|254765388|sp|C1DAU1|RS11_LARHH RecName: Full=30S ribosomal protein S11
 gi|226714134|gb|ACO73272.1| RpsK [Laribacter hongkongensis HLHK9]
          Length = 130

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 66/123 (53%), Positives = 90/123 (73%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R+R + +K++  G AHV ++FNNT ITITD  GN ++W++    GF GSRK++PFAAQ+A
Sbjct: 8   RVRKKVKKSVSEGIAHVHASFNNTIITITDRQGNALSWATSGGAGFKGSRKSTPFAAQIA 67

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +     AQ +G+ +LEV++ G G GRDS++RAL A+GF I SI DVT I HNGCRP K+
Sbjct: 68  AEAAGKVAQEYGVKNLEVRIKGPGPGRDSSVRALNALGFKITSISDVTPIPHNGCRPPKK 127

Query: 127 RRI 129
           RRI
Sbjct: 128 RRI 130


>gi|52078636|ref|YP_077427.1| 30S ribosomal protein S11 [Bacillus licheniformis ATCC 14580]
 gi|52783998|ref|YP_089827.1| 30S ribosomal protein S11 [Bacillus licheniformis ATCC 14580]
 gi|319649089|ref|ZP_08003297.1| 30S ribosomal protein S11 [Bacillus sp. BT1B_CT2]
 gi|59798651|sp|Q65P80|RS11_BACLD RecName: Full=30S ribosomal protein S11
 gi|52001847|gb|AAU21789.1| ribosomal protein S11 (BS11) [Bacillus licheniformis ATCC 14580]
 gi|52346500|gb|AAU39134.1| RpsK [Bacillus licheniformis ATCC 14580]
 gi|317388789|gb|EFV69608.1| 30S ribosomal protein S11 [Bacillus sp. BT1B_CT2]
          Length = 131

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI SG AH+ STFNNT +TITD HGN ++WSS   +GF GS+K++PFAAQ+A +
Sbjct: 11  KRRVKKNIESGIAHIRSTFNNTIVTITDVHGNALSWSSAGALGFKGSKKSTPFAAQMAAE 70

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  +  HG+ +LEV V G G+GR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 71  TAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRR 130

Query: 129 I 129
           +
Sbjct: 131 V 131


>gi|31794635|ref|NP_857128.1| 30S ribosomal protein S11 [Mycobacterium bovis AF2122/97]
 gi|121639379|ref|YP_979603.1| 30S ribosomal protein S11 [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|224991875|ref|YP_002646564.1| 30S ribosomal protein S11 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|260188514|ref|ZP_05765988.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis CPHL_A]
 gi|260206830|ref|ZP_05774321.1| 30S ribosomal protein S11 [Mycobacterium tuberculosis K85]
 gi|289449163|ref|ZP_06438907.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis CPHL_A]
 gi|289576195|ref|ZP_06456422.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis K85]
 gi|38605716|sp|P45812|RS11_MYCBO RecName: Full=30S ribosomal protein S11
 gi|152060794|sp|A1KPE5|RS11_MYCBP RecName: Full=30S ribosomal protein S11
 gi|254811034|sp|C1AHR7|RS11_MYCBT RecName: Full=30S ribosomal protein S11
 gi|31620232|emb|CAD95675.1| PROBABLE 30S RIBOSOMAL PROTEIN S11 RPSK [Mycobacterium bovis
           AF2122/97]
 gi|121495027|emb|CAL73513.1| Probable 30S ribosomal protein S11 rpsK [Mycobacterium bovis BCG
           str. Pasteur 1173P2]
 gi|224774990|dbj|BAH27796.1| 30S ribosomal protein S11 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|289422121|gb|EFD19322.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis CPHL_A]
 gi|289540626|gb|EFD45204.1| 30S ribosomal protein S11 rpsK [Mycobacterium tuberculosis K85]
          Length = 139

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 91/124 (73%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
            + R RE+KN+  G AH+ STFNNT +TITDP GN IAW+S   VGF GSRK++PFAAQ+
Sbjct: 16  QKTRRREKKNVPHGAAHIKSTFNNTIVTITDPQGNVIAWASSGHVGFKGSRKSTPFAAQL 75

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A ++ + KAQ+HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNG RP  
Sbjct: 76  AAENAARKAQDHGVRKVDVFVKGPGSGRETAIRSLQAAGLEVGAISDVTPQPHNGVRPPN 135

Query: 126 RRRI 129
           RRR+
Sbjct: 136 RRRV 139


>gi|308233883|ref|ZP_07664620.1| SSU ribosomal protein S11P [Atopobium vaginae DSM 15829]
 gi|328943590|ref|ZP_08241055.1| 30S ribosomal protein S11 [Atopobium vaginae DSM 15829]
 gi|327491559|gb|EGF23333.1| 30S ribosomal protein S11 [Atopobium vaginae DSM 15829]
          Length = 132

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/132 (54%), Positives = 91/132 (68%), Gaps = 3/132 (2%)

Query: 1   MPKSPSR---IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRK 57
           MPK   +   IR  ERKNI  G+AH+ STFNNT I+ITDP GN IAW S   VGF GSRK
Sbjct: 1   MPKKNQKTQHIRRSERKNIAVGQAHIKSTFNNTTISITDPQGNVIAWQSGGTVGFKGSRK 60

Query: 58  NSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIA 117
           ++PFAAQVA + C+  A  HG+  + V V G G+GR++A+R+L+A G  +  I D T + 
Sbjct: 61  STPFAAQVAAEACAKAAMEHGLHKVAVFVKGPGSGRETAIRSLQAAGLEVSGIQDKTPVP 120

Query: 118 HNGCRPRKRRRI 129
           HNGCRP KRRR+
Sbjct: 121 HNGCRPCKRRRV 132


>gi|268609566|ref|ZP_06143293.1| 30S ribosomal protein S11 [Ruminococcus flavefaciens FD-1]
          Length = 134

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 87/121 (71%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R RERKNI SG  H+ STFNNT +TITD  GN I+W+S   +GF GS+K++PFAAQ A +
Sbjct: 14  RRRERKNIESGAVHIQSTFNNTIVTITDTAGNAISWASAGELGFRGSKKSTPFAAQTAAE 73

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ ++EV V G GAGR++A+RAL+ +G  +  I DVT I HNGCRP KRRR
Sbjct: 74  TAAKAAMEHGLKNVEVYVKGPGAGREAAIRALQTVGLEVRMIKDVTPIPHNGCRPPKRRR 133

Query: 129 I 129
           +
Sbjct: 134 V 134


>gi|308272955|emb|CBX29559.1| 30S ribosomal protein S11 [uncultured Desulfobacterium sp.]
          Length = 128

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 85/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI SG  H+ STFNNT I+ITDP GN + WSS  V GF GSRK++PFAAQ+A +D + KA
Sbjct: 14  NIPSGVVHIYSTFNNTIISITDPAGNVVGWSSAGVQGFKGSRKSTPFAAQLAAEDAAKKA 73

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HGM +++V V G G GR+SALRAL++ GF I+ I DVT I HNGCR  KRRR+
Sbjct: 74  MEHGMKNVDVYVKGPGPGRESALRALQSTGFNILMIKDVTPIPHNGCRSPKRRRV 128


>gi|160914536|ref|ZP_02076751.1| hypothetical protein EUBDOL_00542 [Eubacterium dolichum DSM 3991]
 gi|158433694|gb|EDP11983.1| hypothetical protein EUBDOL_00542 [Eubacterium dolichum DSM 3991]
          Length = 131

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 81/120 (67%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + + RKNI  G AH+ STFNNT +TITD  GN +AWSS   +GF GSRK++PFAAQ+A +
Sbjct: 11  KRKARKNIARGCAHIHSTFNNTIVTITDESGNAVAWSSAGALGFKGSRKSTPFAAQMAGE 70

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
                A  +GM ++ V V G G GR++A+RAL+  G  I  I DVT I HNGCRP KR R
Sbjct: 71  AAGKAAMENGMKTVSVNVKGPGPGREAAVRALQVAGLEITMINDVTPIPHNGCRPPKRPR 130


>gi|157690926|ref|YP_001485388.1| 30S ribosomal protein S11 [Bacillus pumilus SAFR-032]
 gi|194017599|ref|ZP_03056210.1| ribosomal protein S11 [Bacillus pumilus ATCC 7061]
 gi|166991576|sp|A8F9B1|RS11_BACP2 RecName: Full=30S ribosomal protein S11
 gi|157679684|gb|ABV60828.1| ribosomal protein S11 [Bacillus pumilus SAFR-032]
 gi|194010871|gb|EDW20442.1| ribosomal protein S11 [Bacillus pumilus ATCC 7061]
          Length = 131

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT +TITD HGN I+WSS   +GF GSRK++PFAAQ+A +
Sbjct: 11  KRRVKKNIEAGIAHIRSTFNNTIVTITDVHGNAISWSSAGALGFRGSRKSTPFAAQMAAE 70

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  +  HG+ +LEV V G G+GR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 71  TAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRR 130

Query: 129 I 129
           +
Sbjct: 131 V 131


>gi|88704353|ref|ZP_01102067.1| 30S ribosomal protein S11 [Congregibacter litoralis KT71]
 gi|254516933|ref|ZP_05128991.1| ribosomal protein S11 [gamma proteobacterium NOR5-3]
 gi|88701404|gb|EAQ98509.1| 30S ribosomal protein S11 [Congregibacter litoralis KT71]
 gi|219674438|gb|EED30806.1| ribosomal protein S11 [gamma proteobacterium NOR5-3]
          Length = 130

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 86/121 (71%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +  + I  G AH+ ++FNNT ITITD  GNT++W++    GF GSRK++PFAAQVA +
Sbjct: 10  RKKITRTIADGIAHIHASFNNTIITITDRQGNTLSWATSGGSGFRGSRKSTPFAAQVAAE 69

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
                A+ +G+ +L+V+V G G GR+SA+RAL A G+ I +I DVT I HNGCRP K+RR
Sbjct: 70  RAGEAAKEYGLQNLDVQVKGPGPGRESAVRALNACGYKISNITDVTPIPHNGCRPPKKRR 129

Query: 129 I 129
           +
Sbjct: 130 V 130


>gi|312866503|ref|ZP_07726720.1| 30S ribosomal protein S11 [Streptococcus downei F0415]
 gi|311097934|gb|EFQ56161.1| 30S ribosomal protein S11 [Streptococcus downei F0415]
          Length = 127

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 92/125 (73%), Gaps = 1/125 (0%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P+R R R +KNI SG AH+ +TFNNT + ITD HGN +AWSS   +GF GSRK++PFAAQ
Sbjct: 4   PTRKR-RVKKNIESGVAHIHATFNNTIVMITDVHGNALAWSSAGALGFKGSRKSTPFAAQ 62

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           +A +  +  AQ+HG+ ++EV V G G+GR+SA+RAL A G  + +I DVT + HNG RP 
Sbjct: 63  MAAEAAAKSAQDHGLKTVEVTVKGPGSGRESAIRALAAAGLEVTAIRDVTPVPHNGARPP 122

Query: 125 KRRRI 129
           KRRR+
Sbjct: 123 KRRRV 127


>gi|327399497|ref|YP_004340366.1| 30S ribosomal protein S11 [Hippea maritima DSM 10411]
 gi|327182126|gb|AEA34307.1| 30S ribosomal protein S11 [Hippea maritima DSM 10411]
          Length = 128

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 83/115 (72%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+ SG AH+ +TFNNT ITITD  GN + WSS    GF G+RK +PFAAQ+A ++ + KA
Sbjct: 14  NVASGIAHIQATFNNTIITITDQDGNVLCWSSAGDSGFKGTRKGTPFAAQLAAENVAKKA 73

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            + GM  ++V+V G G GR++A+R+L++ G  + SI DVT I HNGCRP KRRR+
Sbjct: 74  MSMGMKEIDVRVKGPGPGRETAIRSLQSAGLRVKSIKDVTPIPHNGCRPPKRRRV 128


>gi|224510712|pdb|3FIH|K Chain K, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
           Consists Of The 30s Subunit, Trnas And The Ternary
           Complex.
 gi|251837147|pdb|3IY8|K Chain K, Leishmania Tarentolae Mitonchondrial Ribosome Small
           Subunit
 gi|294662227|pdb|2WWL|K Chain K, E.Coli 70s Ribosome Stalled During Translation Of Tnac
           Leader Peptide. This File Contains The 30s, The P-Site
           Trna And The Tnac Leader Peptide (Part 1 Of 2).
 gi|308387975|pdb|3OFO|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 gi|308387996|pdb|3OFP|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 gi|309320033|pdb|3OFA|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 30s Subunit Of
           The First 70s Ribosome.
 gi|309320054|pdb|3OFB|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 30s Subunit Of
           The Second 70s Ribosome.
 gi|309320137|pdb|3OFX|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 gi|309320158|pdb|3OFY|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome
 gi|315113622|pdb|3OAQ|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 gi|315113643|pdb|3OAR|K Chain K, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome
          Length = 117

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 82/117 (70%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++PFAAQVA + C+ 
Sbjct: 1   RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCAD 60

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNGCRP K+RR+
Sbjct: 61  AVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV 117


>gi|297618357|ref|YP_003703516.1| 30S ribosomal protein S11 [Syntrophothermus lipocalidus DSM 12680]
 gi|297146194|gb|ADI02951.1| 30S ribosomal protein S11 [Syntrophothermus lipocalidus DSM 12680]
          Length = 130

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 91/127 (71%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K+ +R++ +ERKNI  G AH+ STFNNT +TITD  GN I+W+S   VGF GSRK++PFA
Sbjct: 4   KTTTRVKRKERKNIDYGIAHIKSTFNNTIVTITDRQGNVISWASAGTVGFKGSRKSTPFA 63

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ A ++ +  A  HG+  +E  V G GAGR++A+R+L+A G  +  I DVT I HNGCR
Sbjct: 64  AQQAAENAAKAAMEHGVREVECYVKGPGAGREAAIRSLQAAGLDVSVIKDVTPIPHNGCR 123

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 124 PPKRRRV 130


>gi|297582476|ref|YP_003698256.1| 30S ribosomal protein S11 [Bacillus selenitireducens MLS10]
 gi|297140933|gb|ADH97690.1| 30S ribosomal protein S11 [Bacillus selenitireducens MLS10]
          Length = 130

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 69/128 (53%), Positives = 92/128 (71%), Gaps = 1/128 (0%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK+ +R + R+RKNI SG AH+ STFNNT +TITD  GN I+W+S   +GF GSRK++PF
Sbjct: 4   PKT-TRQKRRQRKNIESGVAHIRSTFNNTIVTITDTQGNAISWASAGALGFKGSRKSTPF 62

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ A +  +  A  HGM ++ V V G GAGR++A+R+L+A G  +  I DVT + HNGC
Sbjct: 63  AAQTAAETAAKAAMEHGMKTVVVSVKGPGAGREAAIRSLQAAGLEVNMIKDVTPVPHNGC 122

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 123 RPPKRRRV 130


>gi|266620236|ref|ZP_06113171.1| 30S ribosomal protein S11 [Clostridium hathewayi DSM 13479]
 gi|302388061|ref|YP_003823883.1| 30S ribosomal protein S11 [Clostridium saccharolyticum WM1]
 gi|288868140|gb|EFD00439.1| 30S ribosomal protein S11 [Clostridium hathewayi DSM 13479]
 gi|302198689|gb|ADL06260.1| 30S ribosomal protein S11 [Clostridium saccharolyticum WM1]
          Length = 133

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 85/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GSRK++P+AAQ+A +  +  A
Sbjct: 19  NVERGQAHIQSSFNNTIVTLTDTQGNALSWASAGGLGFRGSRKSTPYAAQMAAETATKAA 78

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ S++V V G G+GR++A+RAL+A G  + SI DVT + HNGCRP KRRR+
Sbjct: 79  LVHGLKSVDVMVKGPGSGREAAIRALQACGLEVTSIKDVTPVPHNGCRPPKRRRV 133


>gi|159039807|ref|YP_001539060.1| 30S ribosomal protein S11 [Salinispora arenicola CNS-205]
 gi|238061096|ref|ZP_04605805.1| 30S ribosomal protein S11 [Micromonospora sp. ATCC 39149]
 gi|330470146|ref|YP_004407889.1| 30S ribosomal protein S11 [Verrucosispora maris AB-18-032]
 gi|189040431|sp|A8M502|RS11_SALAI RecName: Full=30S ribosomal protein S11
 gi|157918642|gb|ABW00070.1| ribosomal protein S11 [Salinispora arenicola CNS-205]
 gi|237882907|gb|EEP71735.1| 30S ribosomal protein S11 [Micromonospora sp. ATCC 39149]
 gi|328813117|gb|AEB47289.1| 30S ribosomal protein S11 [Verrucosispora maris AB-18-032]
          Length = 135

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 91/123 (73%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +ERKN+  G+AH+ STFNNT ++ITDP G  I+W+S   VGF GSRK++PFAAQ+A
Sbjct: 13  KVRRKERKNVAHGQAHIKSTFNNTIVSITDPTGAVISWASAGQVGFKGSRKSTPFAAQLA 72

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +A  HGM  ++V V G G+GR++A+R+L+A+G  +  I DVT   HNGCRP KR
Sbjct: 73  AEAAARRAMEHGMRKVDVFVKGPGSGRETAIRSLQAVGLEVGQISDVTPQPHNGCRPPKR 132

Query: 127 RRI 129
           RR+
Sbjct: 133 RRV 135


>gi|227509955|ref|ZP_03940004.1| ribosomal protein S11 [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
 gi|227512888|ref|ZP_03942937.1| ribosomal protein S11 [Lactobacillus buchneri ATCC 11577]
 gi|227523016|ref|ZP_03953065.1| ribosomal protein S11 [Lactobacillus hilgardii ATCC 8290]
 gi|227083888|gb|EEI19200.1| ribosomal protein S11 [Lactobacillus buchneri ATCC 11577]
 gi|227089834|gb|EEI25146.1| ribosomal protein S11 [Lactobacillus hilgardii ATCC 8290]
 gi|227190561|gb|EEI70628.1| ribosomal protein S11 [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
          Length = 129

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 90/127 (70%), Gaps = 1/127 (0%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K  SR R R +KNI SG AH+ STFNNT + ITD  GN IAWSS   +GF GSRK++PFA
Sbjct: 4   KKSSRKR-RTKKNIASGVAHIHSTFNNTLVMITDTQGNAIAWSSAGALGFRGSRKSTPFA 62

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  +  +  HGM S+EV V G G+GR++A+RAL+A G  + +I DVT + HNG R
Sbjct: 63  AQMAAEAAAKSSMEHGMKSVEVAVKGPGSGREAAIRALQATGLEVTAIRDVTPVPHNGSR 122

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 123 PPKRRRV 129


>gi|323340398|ref|ZP_08080655.1| 30S ribosomal protein S11 [Lactobacillus ruminis ATCC 25644]
 gi|323092174|gb|EFZ34789.1| 30S ribosomal protein S11 [Lactobacillus ruminis ATCC 25644]
          Length = 128

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 86/115 (74%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI SG AH+ STFNNT + ITD HGN +AWSS   +GF GSRK++PFAAQ+A +  +  A
Sbjct: 14  NIESGVAHIHSTFNNTLVMITDVHGNAVAWSSAGALGFKGSRKSTPFAAQMAAEAAAKGA 73

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            +HGM ++EV V G G+GR++A+RAL+A G  + SI DVT + HNGCRP KRRR+
Sbjct: 74  MDHGMKNVEVAVKGPGSGREAAIRALQATGLEVTSIKDVTPVPHNGCRPPKRRRV 128


>gi|302869944|ref|YP_003838581.1| 30S ribosomal protein S11 [Micromonospora aurantiaca ATCC 27029]
 gi|315501405|ref|YP_004080292.1| 30S ribosomal protein s11 [Micromonospora sp. L5]
 gi|302572803|gb|ADL49005.1| 30S ribosomal protein S11 [Micromonospora aurantiaca ATCC 27029]
 gi|315408024|gb|ADU06141.1| 30S ribosomal protein S11 [Micromonospora sp. L5]
          Length = 135

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 91/123 (73%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +ERKN+  G+AH+ STFNNT ++ITDP G  I+W+S   VGF GSRK++PFAAQ+A
Sbjct: 13  KVRRKERKNVAHGQAHIKSTFNNTIVSITDPTGAVISWASSGQVGFKGSRKSTPFAAQLA 72

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +A  HGM  ++V V G G+GR++A+R+L+A+G  +  I DVT   HNGCRP KR
Sbjct: 73  AEAAARRAMEHGMRKVDVFVKGPGSGRETAIRSLQAVGLEVGQISDVTPQPHNGCRPPKR 132

Query: 127 RRI 129
           RR+
Sbjct: 133 RRV 135


>gi|116671487|ref|YP_832420.1| 30S ribosomal protein S11 [Arthrobacter sp. FB24]
 gi|152060573|sp|A0JZ50|RS11_ARTS2 RecName: Full=30S ribosomal protein S11
 gi|116611596|gb|ABK04320.1| SSU ribosomal protein S11P [Arthrobacter sp. FB24]
          Length = 133

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 92/121 (76%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +++KNI  G+AH+ STFNNT ++ITDP+G  I+W+S   VGF GSRK++PFAAQ+A +
Sbjct: 13  RKKDKKNIALGQAHIKSTFNNTIVSITDPNGAVISWASAGEVGFKGSRKSTPFAAQMAAE 72

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + +AQ HG+  ++V V G G+GR++A+R+L+A G  + SI DVT  AHNGCRP KRRR
Sbjct: 73  AAAKRAQEHGLKKVDVFVKGPGSGRETAIRSLQAAGLEVGSIQDVTPAAHNGCRPPKRRR 132

Query: 129 I 129
           +
Sbjct: 133 V 133


>gi|50955541|ref|YP_062829.1| 30S ribosomal protein S11 [Leifsonia xyli subsp. xyli str. CTCB07]
 gi|59798681|sp|Q6AD20|RS11_LEIXX RecName: Full=30S ribosomal protein S11
 gi|50952023|gb|AAT89724.1| 30S ribosomal protein S11 [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 132

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 95/129 (73%), Gaps = 1/129 (0%)

Query: 2   PKSPSRI-RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           PKS +R  R +E+KNI  G+AH+ STFNNT ++ITD  G  ++W+S   VGF GSRK++P
Sbjct: 4   PKSAARKPRKKEKKNIAVGQAHIKSTFNNTIVSITDTTGAVLSWASSGGVGFKGSRKSTP 63

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +  + +AQ HGM  ++V V G G+GR++A+R+L+A G  + SI DVT  AHNG
Sbjct: 64  YAAQLAAESAARQAQEHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVGSINDVTPQAHNG 123

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 124 CRPPKRRRV 132


>gi|78045178|ref|YP_361092.1| 30S ribosomal protein S11 [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|91207735|sp|Q3A9U2|RS11_CARHZ RecName: Full=30S ribosomal protein S11
 gi|77997293|gb|ABB16192.1| ribosomal protein S11 [Carboxydothermus hydrogenoformans Z-2901]
          Length = 129

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 91/124 (73%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           ++ R +E+K++  G AH+ STFNNT +TITDP GNT++W+S   VGF G+RK +PFAAQ+
Sbjct: 6   TKARKKEKKHVEQGVAHIKSTFNNTIVTITDPQGNTLSWASAGTVGFEGTRKGTPFAAQL 65

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  + +A   G+ ++EV V G GAGR++A+R+L+A G  +  I DVT I HNGCRP K
Sbjct: 66  AAEKAAKEAMEFGVKTVEVYVKGPGAGREAAIRSLQAAGLEVSLIKDVTPIPHNGCRPPK 125

Query: 126 RRRI 129
           RRR+
Sbjct: 126 RRRV 129


>gi|139438876|ref|ZP_01772336.1| Hypothetical protein COLAER_01340 [Collinsella aerofaciens ATCC
           25986]
 gi|133775587|gb|EBA39407.1| Hypothetical protein COLAER_01340 [Collinsella aerofaciens ATCC
           25986]
          Length = 134

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 91/124 (73%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R++  +RKNI  G+AH+ STFNNT ++ITDP GN I+W S   VGF GSRK++PFAAQ+
Sbjct: 11  ARLKRADRKNISVGQAHIRSTFNNTIVSITDPQGNVISWKSAGQVGFKGSRKSTPFAAQM 70

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  + +A  HGM  + V V G G+GR++A+R+L+A G  + SI D T I HNGCRP+K
Sbjct: 71  AAEAAAKQAMEHGMKKVSVFVKGPGSGRETAIRSLQAAGLEVSSIQDKTPIPHNGCRPKK 130

Query: 126 RRRI 129
           RRR+
Sbjct: 131 RRRV 134


>gi|220913401|ref|YP_002488710.1| 30S ribosomal protein S11 [Arthrobacter chlorophenolicus A6]
 gi|325964133|ref|YP_004242039.1| 30S ribosomal protein S11P [Arthrobacter phenanthrenivorans Sphe3]
 gi|254765362|sp|B8HCX5|RS11_ARTCA RecName: Full=30S ribosomal protein S11
 gi|219860279|gb|ACL40621.1| ribosomal protein S11 [Arthrobacter chlorophenolicus A6]
 gi|323470220|gb|ADX73905.1| SSU ribosomal protein S11P [Arthrobacter phenanthrenivorans Sphe3]
          Length = 133

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 91/121 (75%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +++KNI  G+AH+ STFNNT ++ITDP G  I+W+S   VGF GSRK++PFAAQ+A +
Sbjct: 13  RKKDKKNIALGQAHIKSTFNNTIVSITDPTGAVISWASSGEVGFKGSRKSTPFAAQMAAE 72

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + +AQ HGM  ++V V G G+GR++A+R+L+A G  + SI DVT  AHNGCRP KRRR
Sbjct: 73  AAAKRAQEHGMRKVDVFVKGPGSGRETAIRSLQAAGLEVGSIQDVTPAAHNGCRPPKRRR 132

Query: 129 I 129
           +
Sbjct: 133 V 133


>gi|167767778|ref|ZP_02439831.1| hypothetical protein CLOSS21_02313 [Clostridium sp. SS2/1]
 gi|317497069|ref|ZP_07955396.1| 30S ribosomal protein S11 [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167710517|gb|EDS21096.1| hypothetical protein CLOSS21_02313 [Clostridium sp. SS2/1]
 gi|291558881|emb|CBL37681.1| SSU ribosomal protein S11P [butyrate-producing bacterium SSC/2]
 gi|316895614|gb|EFV17769.1| 30S ribosomal protein S11 [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 130

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 84/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GS+K++P+AAQ+A +  +  A
Sbjct: 16  NVQHGQAHIQSSFNNTIVTLTDAQGNALSWASAGGLGFRGSKKSTPYAAQMAAETATKAA 75

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ S++V V G G+GR++A+RAL A G  + SI DVT + HNGCRP KRRR+
Sbjct: 76  LVHGLKSVDVMVKGPGSGREAAIRALSAAGLEVTSISDVTPVPHNGCRPPKRRRV 130


>gi|19745266|ref|NP_606402.1| 30S ribosomal protein S11 [Streptococcus pyogenes MGAS8232]
 gi|25010158|ref|NP_734553.1| 30S ribosomal protein S11 [Streptococcus agalactiae NEM316]
 gi|28894979|ref|NP_801329.1| 30S ribosomal protein S11 [Streptococcus pyogenes SSI-1]
 gi|50913464|ref|YP_059436.1| 30S ribosomal protein S11 [Streptococcus pyogenes MGAS10394]
 gi|71902734|ref|YP_279537.1| 30S ribosomal protein S11 [Streptococcus pyogenes MGAS6180]
 gi|94987700|ref|YP_595801.1| 30S ribosomal protein S11 [Streptococcus pyogenes MGAS9429]
 gi|94989581|ref|YP_597681.1| 30S ribosomal protein S11 [Streptococcus pyogenes MGAS10270]
 gi|94991569|ref|YP_599668.1| 30S ribosomal protein S11 [Streptococcus pyogenes MGAS2096]
 gi|94993469|ref|YP_601567.1| 30S ribosomal protein S11 [Streptococcus pyogenes MGAS10750]
 gi|139472952|ref|YP_001127667.1| 30S ribosomal protein S11 [Streptococcus pyogenes str. Manfredo]
 gi|161485618|ref|NP_687119.2| 30S ribosomal protein S11 [Streptococcus agalactiae 2603V/R]
 gi|161485756|ref|NP_663869.2| 30S ribosomal protein S11 [Streptococcus pyogenes MGAS315]
 gi|161486743|ref|YP_328808.2| 30S ribosomal protein S11 [Streptococcus agalactiae A909]
 gi|195977233|ref|YP_002122477.1| 30S ribosomal protein S11 [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|222152290|ref|YP_002561465.1| 30S ribosomal protein S11 [Streptococcus uberis 0140J]
 gi|225867690|ref|YP_002743638.1| 30S ribosomal protein S11 [Streptococcus equi subsp. zooepidemicus]
 gi|225869561|ref|YP_002745508.1| 30S ribosomal protein S11 [Streptococcus equi subsp. equi 4047]
 gi|251781543|ref|YP_002995844.1| 30S ribosomal protein S11 [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|306828236|ref|ZP_07461496.1| 30S ribosomal protein S11 [Streptococcus pyogenes ATCC 10782]
 gi|313889546|ref|ZP_07823191.1| 30S ribosomal protein S11 [Streptococcus pseudoporcinus SPIN 20026]
 gi|329117662|ref|ZP_08246379.1| 30S ribosomal protein S11 [Streptococcus parauberis NCFD 2020]
 gi|54039336|sp|P66362|RS11_STRP8 RecName: Full=30S ribosomal protein S11
 gi|54039337|sp|P66363|RS11_STRA3 RecName: Full=30S ribosomal protein S11
 gi|54039338|sp|P66364|RS11_STRA5 RecName: Full=30S ribosomal protein S11
 gi|54042112|sp|P66361|RS11_STRP3 RecName: Full=30S ribosomal protein S11
 gi|59798614|sp|Q5XEB0|RS11_STRP6 RecName: Full=30S ribosomal protein S11
 gi|91207681|sp|Q3K3U5|RS11_STRA1 RecName: Full=30S ribosomal protein S11
 gi|91207682|sp|Q48VS4|RS11_STRPM RecName: Full=30S ribosomal protein S11
 gi|122986873|sp|Q1J8Y8|RS11_STRPF RecName: Full=30S ribosomal protein S11
 gi|122987149|sp|Q1JNZ2|RS11_STRPC RecName: Full=30S ribosomal protein S11
 gi|123382359|sp|Q1JE34|RS11_STRPB RecName: Full=30S ribosomal protein S11
 gi|123382461|sp|Q1JJ36|RS11_STRPD RecName: Full=30S ribosomal protein S11
 gi|152060824|sp|A2RC39|RS11_STRPG RecName: Full=30S ribosomal protein S11
 gi|226708418|sp|B4U525|RS11_STREM RecName: Full=30S ribosomal protein S11
 gi|254811044|sp|C0M7C6|RS11_STRE4 RecName: Full=30S ribosomal protein S11
 gi|254811047|sp|B9DSX5|RS11_STRU0 RecName: Full=30S ribosomal protein S11
 gi|259494635|sp|C0ME30|RS11_STRS7 RecName: Full=30S ribosomal protein S11
 gi|19747361|gb|AAL96901.1| 30S ribosomal protein S11 [Streptococcus pyogenes MGAS8232]
 gi|23094509|emb|CAD45728.1| 30S ribosomal protein S11 [Streptococcus agalactiae NEM316]
 gi|28810224|dbj|BAC63162.1| 30S ribosomal protein S11 [Streptococcus pyogenes SSI-1]
 gi|50902538|gb|AAT86253.1| SSU ribosomal protein S11P [Streptococcus pyogenes MGAS10394]
 gi|71801829|gb|AAX71182.1| SSU ribosomal protein S11P [Streptococcus pyogenes MGAS6180]
 gi|94541208|gb|ABF31257.1| SSU ribosomal protein S11P [Streptococcus pyogenes MGAS9429]
 gi|94543089|gb|ABF33137.1| SSU ribosomal protein S11P [Streptococcus pyogenes MGAS10270]
 gi|94545077|gb|ABF35124.1| SSU ribosomal protein S11P [Streptococcus pyogenes MGAS2096]
 gi|94546977|gb|ABF37023.1| SSU ribosomal protein S11P [Streptococcus pyogenes MGAS10750]
 gi|134271198|emb|CAM29411.1| 30S ribosomal protein S11 [Streptococcus pyogenes str. Manfredo]
 gi|195973938|gb|ACG61464.1| 30S ribosomal protein S11 [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|222113101|emb|CAR40484.1| 30S ribosomal protein S11 [Streptococcus uberis 0140J]
 gi|225698965|emb|CAW92013.1| 30S ribosomal protein S11 [Streptococcus equi subsp. equi 4047]
 gi|225700966|emb|CAW97688.1| 30S ribosomal protein S11 [Streptococcus equi subsp. zooepidemicus]
 gi|242390171|dbj|BAH80630.1| 30S ribosomal protein S11 [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|304429547|gb|EFM32596.1| 30S ribosomal protein S11 [Streptococcus pyogenes ATCC 10782]
 gi|313122055|gb|EFR45149.1| 30S ribosomal protein S11 [Streptococcus pseudoporcinus SPIN 20026]
 gi|319743970|gb|EFV96350.1| 30S ribosomal protein S11 [Streptococcus agalactiae ATCC 13813]
 gi|322410883|gb|EFY01791.1| 30S ribosomal protein S11 [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
 gi|323126336|gb|ADX23633.1| 30S ribosomal protein S11 [Streptococcus dysgalactiae subsp.
           equisimilis ATCC 12394]
 gi|326908067|gb|EGE54981.1| 30S ribosomal protein S11 [Streptococcus parauberis NCFD 2020]
          Length = 127

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 91/125 (72%), Gaps = 1/125 (0%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P+R R R +KNI SG AH+ +TFNNT + ITD HGN +AWSS   +GF GSRK++PFAAQ
Sbjct: 4   PTRKR-RVKKNIESGVAHIHATFNNTIVMITDVHGNALAWSSAGALGFKGSRKSTPFAAQ 62

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           +A +  +  AQ HG+ ++EV V G G+GR+SA+RAL A G  + +I DVT + HNG RP 
Sbjct: 63  MAAEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLEVTAIRDVTPVPHNGARPP 122

Query: 125 KRRRI 129
           KRRR+
Sbjct: 123 KRRRV 127


>gi|297569397|ref|YP_003690741.1| 30S ribosomal protein S11 [Desulfurivibrio alkaliphilus AHT2]
 gi|296925312|gb|ADH86122.1| 30S ribosomal protein S11 [Desulfurivibrio alkaliphilus AHT2]
          Length = 130

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 87/128 (67%), Gaps = 1/128 (0%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK+ +R + R++KNI  G   + STFNNT +T  D  GN I+W S   +GF GSRK++PF
Sbjct: 4   PKT-ARPKKRDKKNIPEGICFIKSTFNNTIVTFADQRGNVISWCSSGCLGFKGSRKSTPF 62

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ A +    KAQ HG+  +EV+V+G G GR+SA+RAL+  G  +  I D+T + HNGC
Sbjct: 63  AAQNAVETAVKKAQEHGLRKVEVRVNGPGPGRESAIRALQVAGIEVNYIRDMTTLPHNGC 122

Query: 122 RPRKRRRI 129
           +P KRRR+
Sbjct: 123 KPPKRRRV 130


>gi|229153914|ref|ZP_04282044.1| 30S ribosomal protein S11 [Bacillus cereus ATCC 4342]
 gi|228629595|gb|EEK86292.1| 30S ribosomal protein S11 [Bacillus cereus ATCC 4342]
          Length = 129

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ STFNNT +T+TD HGN ++WSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KKRVKKNIEAGVAHIRSTFNNTIVTLTDTHGNALSWSSAGALGFRGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ +LEV V G GAGR++ +RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TAAKAAMEHGLKTLEVTVKGPGAGREAVIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|293402526|ref|ZP_06646661.1| 30S ribosomal protein S11 [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291304040|gb|EFE45294.1| 30S ribosomal protein S11 [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 131

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 82/120 (68%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + + RKNI  G AH+ STFNNT +TITD +GN +AWSS   +GF GSRK++PFAAQ+A +
Sbjct: 11  KRKARKNIARGCAHIHSTFNNTIVTITDENGNAVAWSSAGALGFKGSRKSTPFAAQMAGE 70

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
                A  +GM ++ V V G G GR++A+RAL+  G  I  I DVT I HNGCRP KR R
Sbjct: 71  AAGKAAIENGMKTVSVNVKGPGPGREAAVRALQVAGLEITMINDVTPIPHNGCRPPKRPR 130


>gi|189219452|ref|YP_001940093.1| Ribosomal protein S11 [Methylacidiphilum infernorum V4]
 gi|189186310|gb|ACD83495.1| Ribosomal protein S11 [Methylacidiphilum infernorum V4]
          Length = 180

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 83/119 (69%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           R  K I +G  ++++TFNNT +TITD  G TIAWSS    GF G++K++ + AQ+   D 
Sbjct: 62  RTGKAIYNGIVNILATFNNTIVTITDMSGKTIAWSSAGKCGFRGTKKSTAYVAQLVAQDA 121

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + +A  HGM  + VKV G G GR+SA+RAL+A+G  + SI DVT I HNGCRP+K+RR+
Sbjct: 122 ARQAMGHGMREVIVKVKGPGTGRESAIRALQAVGLEVTSILDVTPIPHNGCRPKKQRRV 180


>gi|226953894|ref|ZP_03824358.1| 30S ribosomal protein S11 [Acinetobacter sp. ATCC 27244]
 gi|294651611|ref|ZP_06728915.1| 30S ribosomal protein S11 [Acinetobacter haemolyticus ATCC 19194]
 gi|226835377|gb|EEH67760.1| 30S ribosomal protein S11 [Acinetobacter sp. ATCC 27244]
 gi|292822460|gb|EFF81359.1| 30S ribosomal protein S11 [Acinetobacter haemolyticus ATCC 19194]
          Length = 128

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 87/124 (70%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R R +  + +  G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++PFAAQV
Sbjct: 5   TRTRKKVSRTVSEGVAHIHASFNNTIVTITDRQGNALAWATSGGQGFRGSRKSTPFAAQV 64

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +     A ++G+ +L+V V G G GR+SA+RAL A+G+ I SI DVT I HNGCRP K
Sbjct: 65  AAEVAGKAALDYGLKNLDVLVKGPGPGRESAVRALGAVGYKINSITDVTPIPHNGCRPPK 124

Query: 126 RRRI 129
           +RR+
Sbjct: 125 KRRV 128


>gi|50086192|ref|YP_047702.1| 30S ribosomal protein S11 [Acinetobacter sp. ADP1]
 gi|169632373|ref|YP_001706109.1| 30S ribosomal protein S11 [Acinetobacter baumannii SDF]
 gi|169794617|ref|YP_001712410.1| 30S ribosomal protein S11 [Acinetobacter baumannii AYE]
 gi|184159575|ref|YP_001847914.1| 30S ribosomal protein S11 [Acinetobacter baumannii ACICU]
 gi|213158812|ref|YP_002320810.1| ribosomal protein S11 [Acinetobacter baumannii AB0057]
 gi|215482206|ref|YP_002324388.1| 30S ribosomal protein S11 (BS11) [Acinetobacter baumannii
           AB307-0294]
 gi|239503211|ref|ZP_04662521.1| 30S ribosomal protein S11 [Acinetobacter baumannii AB900]
 gi|255319792|ref|ZP_05360997.1| 30S ribosomal protein S11 [Acinetobacter radioresistens SK82]
 gi|260549817|ref|ZP_05824033.1| ribosomal protein S11 [Acinetobacter sp. RUH2624]
 gi|260557050|ref|ZP_05829267.1| 30S ribosomal protein S11 [Acinetobacter baumannii ATCC 19606]
 gi|262280202|ref|ZP_06057986.1| 30S ribosomal protein S11 [Acinetobacter calcoaceticus RUH2202]
 gi|262370555|ref|ZP_06063880.1| 30S ribosomal protein S11 [Acinetobacter johnsonii SH046]
 gi|262373498|ref|ZP_06066776.1| 30S ribosomal protein S11 [Acinetobacter junii SH205]
 gi|262380325|ref|ZP_06073479.1| 30S ribosomal protein S11 [Acinetobacter radioresistens SH164]
 gi|293610847|ref|ZP_06693147.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|294839724|ref|ZP_06784407.1| 30S ribosomal protein S11 [Acinetobacter sp. 6013113]
 gi|294842676|ref|ZP_06787359.1| 30S ribosomal protein S11 [Acinetobacter sp. 6014059]
 gi|294860402|ref|ZP_06798171.1| 30S ribosomal protein S11 [Acinetobacter sp. 6013150]
 gi|299768689|ref|YP_003730715.1| 30S ribosomal protein S11 [Acinetobacter sp. DR1]
 gi|301345033|ref|ZP_07225774.1| 30S ribosomal protein S11 [Acinetobacter baumannii AB056]
 gi|301512036|ref|ZP_07237273.1| 30S ribosomal protein S11 [Acinetobacter baumannii AB058]
 gi|301595207|ref|ZP_07240215.1| 30S ribosomal protein S11 [Acinetobacter baumannii AB059]
 gi|59798697|sp|Q6F7T5|RS11_ACIAD RecName: Full=30S ribosomal protein S11
 gi|152060565|sp|A3M961|RS11_ACIBT RecName: Full=30S ribosomal protein S11
 gi|226708316|sp|B7GW25|RS11_ACIB3 RecName: Full=30S ribosomal protein S11
 gi|226708317|sp|B7IA16|RS11_ACIB5 RecName: Full=30S ribosomal protein S11
 gi|226708318|sp|B2HZ85|RS11_ACIBC RecName: Full=30S ribosomal protein S11
 gi|226708319|sp|B0VQU1|RS11_ACIBS RecName: Full=30S ribosomal protein S11
 gi|226708320|sp|B0V6U5|RS11_ACIBY RecName: Full=30S ribosomal protein S11
 gi|49532168|emb|CAG69880.1| 30S ribosomal protein S11 [Acinetobacter sp. ADP1]
 gi|169147544|emb|CAM85405.1| 30S ribosomal protein S11 [Acinetobacter baumannii AYE]
 gi|169151165|emb|CAO99837.1| 30S ribosomal protein S11 [Acinetobacter baumannii]
 gi|183211169|gb|ACC58567.1| 30S ribosomal protein S11 [Acinetobacter baumannii ACICU]
 gi|193078464|gb|ABO13455.2| 30S ribosomal protein S11 [Acinetobacter baumannii ATCC 17978]
 gi|213057972|gb|ACJ42874.1| ribosomal protein S11 [Acinetobacter baumannii AB0057]
 gi|213986379|gb|ACJ56678.1| 30S ribosomal protein S11 (BS11) [Acinetobacter baumannii
           AB307-0294]
 gi|255303111|gb|EET82323.1| 30S ribosomal protein S11 [Acinetobacter radioresistens SK82]
 gi|260407067|gb|EEX00544.1| ribosomal protein S11 [Acinetobacter sp. RUH2624]
 gi|260409656|gb|EEX02957.1| 30S ribosomal protein S11 [Acinetobacter baumannii ATCC 19606]
 gi|262257980|gb|EEY76714.1| 30S ribosomal protein S11 [Acinetobacter calcoaceticus RUH2202]
 gi|262297771|gb|EEY85686.1| 30S ribosomal protein S11 [Acinetobacter radioresistens SH164]
 gi|262311251|gb|EEY92337.1| 30S ribosomal protein S11 [Acinetobacter junii SH205]
 gi|262314355|gb|EEY95397.1| 30S ribosomal protein S11 [Acinetobacter johnsonii SH046]
 gi|292827191|gb|EFF85556.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|298698777|gb|ADI89342.1| 30S ribosomal protein S11 [Acinetobacter sp. DR1]
 gi|322509485|gb|ADX04939.1| 30S ribosomal protein S11 [Acinetobacter baumannii 1656-2]
 gi|323519506|gb|ADX93887.1| 30S ribosomal protein S11 [Acinetobacter baumannii TCDC-AB0715]
 gi|325123581|gb|ADY83104.1| 30S ribosomal protein S11 [Acinetobacter calcoaceticus PHEA-2]
          Length = 128

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 87/124 (70%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R R +  + +  G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++PFAAQV
Sbjct: 5   TRTRKKVTRTVSEGVAHIHASFNNTIVTITDRQGNALAWATSGGQGFRGSRKSTPFAAQV 64

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +     A ++G+ +L+V V G G GR+SA+RAL A+G+ I SI DVT I HNGCRP K
Sbjct: 65  AAEVAGKAALDYGLKNLDVLVKGPGPGRESAVRALGAVGYKINSITDVTPIPHNGCRPPK 124

Query: 126 RRRI 129
           +RR+
Sbjct: 125 KRRV 128


>gi|328951210|ref|YP_004368545.1| 30S ribosomal protein S11 [Marinithermus hydrothermalis DSM 14884]
 gi|328451534|gb|AEB12435.1| 30S ribosomal protein S11 [Marinithermus hydrothermalis DSM 14884]
          Length = 127

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/120 (52%), Positives = 89/120 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R + ++ +  G+A++ +T+NNT +TITDP GN IAWSS  V+G+ GSRK +P+AAQ+A  
Sbjct: 7   RKKVKRQVAHGKAYIHATYNNTIVTITDPEGNPIAWSSGGVIGYKGSRKGTPYAAQLAAI 66

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           D + KAQ +GM+ ++V V G GAGR+ A+RAL+A G  + SI D T + HNGCRPRKR+R
Sbjct: 67  DAAKKAQAYGMTQVDVIVRGTGAGREQAIRALQASGLQVRSIVDDTPVPHNGCRPRKRKR 126


>gi|319938482|ref|ZP_08012876.1| 30S ribosomal protein S11 [Coprobacillus sp. 29_1]
 gi|319806398|gb|EFW03065.1| 30S ribosomal protein S11 [Coprobacillus sp. 29_1]
          Length = 131

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 90/126 (71%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K+ +R + R +KNI  G AHV STFNNT +T+TD HGN + WSS   +GF GSRK++P+A
Sbjct: 5   KTNTRGKRRVKKNIAKGVAHVHSTFNNTIVTVTDEHGNVLTWSSAGALGFKGSRKSTPYA 64

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  +  + +HGM S+EV V G G GR++A+RAL+A G  + +I DVT I HNGCR
Sbjct: 65  AQMAAEAAAKASMDHGMKSVEVCVKGPGPGREAAVRALQAAGLEVTAINDVTPIPHNGCR 124

Query: 123 PRKRRR 128
           P KR R
Sbjct: 125 PPKRPR 130


>gi|262377289|ref|ZP_06070513.1| 30S ribosomal protein S11 [Acinetobacter lwoffii SH145]
 gi|262307742|gb|EEY88881.1| 30S ribosomal protein S11 [Acinetobacter lwoffii SH145]
          Length = 128

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 87/124 (70%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R R +  + +  G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++PFAAQV
Sbjct: 5   TRARKKVTRTVSEGVAHIHASFNNTIVTITDRQGNALAWATSGGQGFRGSRKSTPFAAQV 64

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +     A ++G+ +L+V V G G GR+SA+RAL A+G+ I SI DVT I HNGCRP K
Sbjct: 65  AAEVAGKAALDYGLKNLDVLVKGPGPGRESAVRALGAVGYKINSITDVTPIPHNGCRPPK 124

Query: 126 RRRI 129
           +RR+
Sbjct: 125 KRRV 128


>gi|75764944|ref|ZP_00744282.1| SSU ribosomal protein S11P [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|74487568|gb|EAO51446.1| SSU ribosomal protein S11P [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
          Length = 118

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 88/117 (75%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KNI +G AH+ STFNNT +T+TD HGN ++WSS   +GF GSRK++PFAAQ+A +  + 
Sbjct: 2   KKNIEAGIAHIRSTFNNTIVTLTDTHGNALSWSSAGALGFRGSRKSTPFAAQMAAEAAAK 61

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            A  HG+ +LEV V G GAGR++A+RAL+A G  + +I DVT + HNGCRP KRRR+
Sbjct: 62  VAMEHGLKTLEVTVKGPGAGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRRV 118


>gi|325288603|ref|YP_004264784.1| SSU ribosomal protein S11P [Syntrophobotulus glycolicus DSM 8271]
 gi|324964004|gb|ADY54783.1| SSU ribosomal protein S11P [Syntrophobotulus glycolicus DSM 8271]
          Length = 129

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 91/129 (70%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K   R R RERKN+ SG AH+ STFNNT +TI+D  GN I+WSS   +GF GSRK++P
Sbjct: 1   MAKKVVRTRRRERKNVESGIAHIKSTFNNTIVTISDNGGNAISWSSAGALGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  +  A  HGM ++E  V G G+GR++A+RAL+A G  +  I DVT + HNG
Sbjct: 61  FAAQMAAETAAKAAMEHGMKNVECFVKGPGSGREAAIRALQAAGLEVNLIKDVTPVPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|37523142|ref|NP_926519.1| 30S ribosomal protein S11 [Gloeobacter violaceus PCC 7421]
 gi|59798827|sp|Q7NFF3|RS11_GLOVI RecName: Full=30S ribosomal protein S11
 gi|35214145|dbj|BAC91514.1| 30S ribosomal protein S11 [Gloeobacter violaceus PCC 7421]
          Length = 130

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 84/121 (69%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + + R+N+ SG AH+ STFNNT +TI D  G+ I+W+S    GF G++K +PFAAQ A +
Sbjct: 10  KKKVRRNVPSGVAHIQSTFNNTIVTIADTVGDVISWASAGSSGFKGAKKGTPFAAQQAAE 69

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
               +A + GM   EV VSG GAGR++A+RAL+A+G  I  I DVT I HNGCRP KRRR
Sbjct: 70  SAGRRAIDSGMRQCEVMVSGPGAGRETAIRALQAVGLEITLIRDVTPIPHNGCRPPKRRR 129

Query: 129 I 129
           +
Sbjct: 130 V 130


>gi|221195533|ref|ZP_03568588.1| 30S ribosomal protein S11 [Atopobium rimae ATCC 49626]
 gi|221184720|gb|EEE17112.1| 30S ribosomal protein S11 [Atopobium rimae ATCC 49626]
          Length = 133

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/123 (53%), Positives = 88/123 (71%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           + IR  ERKNI  G+AH+ STFNNT ++I+DP GN I+W S   VGF GSRK++PFAAQ+
Sbjct: 10  THIRRSERKNIAVGQAHIKSTFNNTIVSISDPQGNVISWQSGGTVGFKGSRKSTPFAAQL 69

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  +  A  HG+  + V V G G+GR++A+R+L+A G  +  I D T IAHNGCRP+K
Sbjct: 70  AAEAAAKAAMEHGLHKVAVFVKGPGSGRETAIRSLQAAGLEVSGIQDKTPIAHNGCRPKK 129

Query: 126 RRR 128
           RRR
Sbjct: 130 RRR 132


>gi|323357347|ref|YP_004223743.1| ribosomal protein S11 [Microbacterium testaceum StLB037]
 gi|323273718|dbj|BAJ73863.1| ribosomal protein S11 [Microbacterium testaceum StLB037]
          Length = 132

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +E+KNI  G+AH+ STFNNT ++ITDP G  I+W+S   VGF GSRK++P+AA +A +
Sbjct: 12  RRKEKKNIAVGQAHIKSTFNNTIVSITDPSGAVISWASSGGVGFKGSRKSTPYAAGMAAE 71

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + +AQ HG+  ++V V G G+GR++A+R+L A G  + SI DVT  AHNGCRP KRRR
Sbjct: 72  SAARQAQEHGVKKVDVFVKGPGSGRETAIRSLTAAGLEVGSIQDVTPQAHNGCRPPKRRR 131

Query: 129 I 129
           +
Sbjct: 132 V 132


>gi|145596408|ref|YP_001160705.1| 30S ribosomal protein S11 [Salinispora tropica CNB-440]
 gi|189040434|sp|A4XBM0|RS11_SALTO RecName: Full=30S ribosomal protein S11
 gi|145305745|gb|ABP56327.1| SSU ribosomal protein S11P [Salinispora tropica CNB-440]
          Length = 135

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 91/123 (73%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +ERKN+  G+AH+ STFNNT +++TDP G  I+W+S   VGF GSRK++PFAAQ+A
Sbjct: 13  KVRRKERKNVAHGQAHIKSTFNNTIVSVTDPTGAVISWASAGQVGFKGSRKSTPFAAQLA 72

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +A  HGM  ++V V G G+GR++A+R+L+A+G  +  I DVT   HNGCRP KR
Sbjct: 73  AEAAARRAMEHGMRKVDVFVKGPGSGRETAIRSLQAVGLEVGQISDVTPQPHNGCRPPKR 132

Query: 127 RRI 129
           RR+
Sbjct: 133 RRV 135


>gi|323703522|ref|ZP_08115168.1| 30S ribosomal protein S11 [Desulfotomaculum nigrificans DSM 574]
 gi|323531513|gb|EGB21406.1| 30S ribosomal protein S11 [Desulfotomaculum nigrificans DSM 574]
          Length = 129

 Score =  128 bits (322), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 90/129 (69%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +   R + +E+KN+  G AH+ STFNNT +TITD  GNT+ WSS   VGF GSRK++P
Sbjct: 1   MARRQVRAKRKEKKNVEQGVAHIKSTFNNTIVTITDLKGNTLGWSSAGQVGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  +  A  HG+  +EV V G G+GR++A+R+L+A G  +  I DVT I HNG
Sbjct: 61  FAAQMAAEAAAKDAMEHGLKEVEVTVKGPGSGREAAIRSLQAAGLEVSVIKDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|83648829|ref|YP_437264.1| 30S ribosomal protein S11 [Hahella chejuensis KCTC 2396]
 gi|123739821|sp|Q2S935|RS11_HAHCH RecName: Full=30S ribosomal protein S11
 gi|83636872|gb|ABC32839.1| Ribosomal protein S11 [Hahella chejuensis KCTC 2396]
          Length = 129

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 64/129 (49%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R R + +K +V G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKPGTRTRKKVKKTVVDGVAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     A  +G+ +L+V V G G GR+SA+RAL A G+ I +I DVT I HNG
Sbjct: 61  FAAQVAAERAGNAAAEYGLKNLDVLVKGPGPGRESAIRALNACGYKITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|121534658|ref|ZP_01666479.1| ribosomal protein S11 [Thermosinus carboxydivorans Nor1]
 gi|121306678|gb|EAX47599.1| ribosomal protein S11 [Thermosinus carboxydivorans Nor1]
          Length = 130

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 90/127 (70%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K  +R + +ERKNI  G AH+ STFNNT +TITD  GN ++W+S   +GF GSRK++PFA
Sbjct: 4   KKVARPKRKERKNIEHGVAHIRSTFNNTIVTITDSKGNAVSWASAGALGFKGSRKSTPFA 63

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  +  A  HGM  +EV V G GAGR++A+R+L+A G  +  I DVT I HNGCR
Sbjct: 64  AQMAAEQAAKAAMEHGMKQVEVYVKGPGAGREAAIRSLQAAGLEVNLIKDVTPIPHNGCR 123

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 124 PPKRRRV 130


>gi|262203542|ref|YP_003274750.1| 30S ribosomal protein S11 [Gordonia bronchialis DSM 43247]
 gi|262086889|gb|ACY22857.1| 30S ribosomal protein S11 [Gordonia bronchialis DSM 43247]
          Length = 135

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 92/121 (76%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R R++KN+  G AH+ STFNNT ++I+DP+GN I+W+S   VGF GSRK++PFAAQ+A +
Sbjct: 15  RRRDKKNVPHGTAHIKSTFNNTIVSISDPNGNVISWASSGHVGFKGSRKSTPFAAQLAAE 74

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           + + KAQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGCRP KRRR
Sbjct: 75  NAARKAQEHGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGTISDVTPQPHNGCRPPKRRR 134

Query: 129 I 129
           +
Sbjct: 135 V 135


>gi|37912968|gb|AAR05300.1| ribosomal protein S11 [uncultured marine gamma proteobacterium
           EB000-45B06]
 gi|40063199|gb|AAR38036.1| ribosomal protein S11 [uncultured marine bacterium 562]
          Length = 125

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 80/114 (70%)

Query: 16  IVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQ 75
           +  G AH+ S+FNNT +TITD  GNT+ W++    GF GSRK++PFAAQ+A D     A+
Sbjct: 12  VTDGVAHIHSSFNNTIVTITDKQGNTVCWATSGGSGFKGSRKSTPFAAQIAADKAGNAAK 71

Query: 76  NHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             GM +L+VKV G G GR+SA+R+L A G  I SI DVT + HNGCRP K+RR+
Sbjct: 72  EFGMINLDVKVKGPGGGRESAIRSLNACGLKIKSITDVTPLPHNGCRPSKKRRV 125


>gi|323490648|ref|ZP_08095853.1| 30S ribosomal protein S11 (BS11) [Planococcus donghaensis MPA1U2]
 gi|323395740|gb|EGA88581.1| 30S ribosomal protein S11 (BS11) [Planococcus donghaensis MPA1U2]
          Length = 129

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI SG AH+ STFNNT +TITD  GN ++WSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVKKNIESGIAHIRSTFNNTIVTITDMQGNAVSWSSAGALGFRGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  +  HG+ +LEV V G G+GR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TAAKTSIEHGLKTLEVTVKGPGSGREAAIRALQAAGLEVTAIKDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|23097599|ref|NP_691065.1| 30S ribosomal protein S11 [Oceanobacillus iheyensis HTE831]
 gi|48474281|sp|P59373|RS11_OCEIH RecName: Full=30S ribosomal protein S11
 gi|22775822|dbj|BAC12100.1| 30S ribosomal protein S11 [Oceanobacillus iheyensis HTE831]
          Length = 129

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 88/121 (72%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI SG AH+ STFNNT +TITD  GN I WSS   +GF GS+K++PFAAQ+A +
Sbjct: 9   KRRVKKNIESGIAHIRSTFNNTIVTITDTRGNAIGWSSAGALGFKGSKKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  +GM +LEV V G GAGR++A+R+L+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TAAKSAIENGMKTLEVTVKGPGAGREAAIRSLQAAGLEVTAIVDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|224542264|ref|ZP_03682803.1| hypothetical protein CATMIT_01439 [Catenibacterium mitsuokai DSM
           15897]
 gi|224524806|gb|EEF93911.1| hypothetical protein CATMIT_01439 [Catenibacterium mitsuokai DSM
           15897]
          Length = 129

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 88/128 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K   R + R +KNI  G AHV STFNNT +T+ D HGN I+WSS   +GF GSRK++P
Sbjct: 1   MAKQVVRGKKRVKKNIAKGIAHVHSTFNNTIVTVADEHGNVISWSSAGALGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A +  +  + +HGM S+EV V G G GR++A+RAL A G  + +I DVT I HNG
Sbjct: 61  YAAQMAAEAAAKASMDHGMKSVEVCVKGPGPGREAAVRALSAAGLEVTAITDVTPIPHNG 120

Query: 121 CRPRKRRR 128
           CRP KR R
Sbjct: 121 CRPPKRPR 128


>gi|329893622|ref|ZP_08269756.1| SSU ribosomal protein S11p (S14e) [gamma proteobacterium IMCC3088]
 gi|328923549|gb|EGG30861.1| SSU ribosomal protein S11p (S14e) [gamma proteobacterium IMCC3088]
          Length = 130

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 85/121 (70%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +  K +V G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++PFAAQVA +
Sbjct: 10  RRKITKTVVDGVAHIHASFNNTIVTITDRQGNALSWATAGGSGFRGSRKSTPFAAQVAAE 69

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
                A+ +G+ +L+V+V G G GR+SA+RAL   G+ I +I DVT I HNGCRP K+RR
Sbjct: 70  RAGEAAKEYGLKNLDVQVKGPGPGRESAVRALNGCGYKITNITDVTPIPHNGCRPPKKRR 129

Query: 129 I 129
           +
Sbjct: 130 V 130


>gi|328953132|ref|YP_004370466.1| 30S ribosomal protein S11 [Desulfobacca acetoxidans DSM 11109]
 gi|328453456|gb|AEB09285.1| 30S ribosomal protein S11 [Desulfobacca acetoxidans DSM 11109]
          Length = 131

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 87/115 (75%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI +G AH+ STFNNT +TITDP GN ++WSS  + GF GSRK++PFAAQ+A +D + KA
Sbjct: 17  NIPTGVAHIQSTFNNTIVTITDPAGNVVSWSSSGIQGFKGSRKSTPFAAQLAAEDAAKKA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
              GM +++V V G GAGR++A+RAL+  GFTI  I DVT I HNGCRP KRRR+
Sbjct: 77  MEQGMRTIDVFVKGPGAGREAAIRALQVAGFTINLIRDVTPIPHNGCRPPKRRRV 131


>gi|281357931|ref|ZP_06244416.1| 30S ribosomal protein S11 [Victivallis vadensis ATCC BAA-548]
 gi|281315589|gb|EFA99617.1| 30S ribosomal protein S11 [Victivallis vadensis ATCC BAA-548]
          Length = 148

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 84/121 (69%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +  + + SG A+V++TFNNT++T TD HGN I WS+    GF GSRK++ +AAQV   
Sbjct: 28  RGKTGRYVPSGIAYVLATFNNTKVTFTDLHGNVICWSTGGKNGFKGSRKSTAYAAQVIAG 87

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           D + KAQ  GM  +EV++ G GAGR+SA+R + A G  I +I D+T + HNGCRP KRRR
Sbjct: 88  DAAKKAQLVGMKEVEVRIKGPGAGRESAVRGIAAAGMEISTIKDITPVPHNGCRPPKRRR 147

Query: 129 I 129
           +
Sbjct: 148 V 148


>gi|90962381|ref|YP_536297.1| 30S ribosomal protein S11 [Lactobacillus salivarius UCC118]
 gi|227891569|ref|ZP_04009374.1| 30S ribosomal protein S11 [Lactobacillus salivarius ATCC 11741]
 gi|301300234|ref|ZP_07206446.1| 30S ribosomal protein S11 [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|122993042|sp|Q1WSB5|RS11_LACS1 RecName: Full=30S ribosomal protein S11
 gi|90821575|gb|ABE00214.1| SSU ribosomal protein S11P [Lactobacillus salivarius UCC118]
 gi|227866716|gb|EEJ74137.1| 30S ribosomal protein S11 [Lactobacillus salivarius ATCC 11741]
 gi|300852175|gb|EFK79847.1| 30S ribosomal protein S11 [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 128

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/115 (56%), Positives = 85/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI SG AH+ STFNNT + ITD HGN +AWSS   +GF GSRK++PFAAQ+A++  +  A
Sbjct: 14  NIESGVAHIHSTFNNTLVMITDVHGNAVAWSSAGSLGFKGSRKSTPFAAQMASEAAAKGA 73

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HGM ++EV V G G+GR++A+RAL+  G  + SI DVT + HNGCRP KRRR+
Sbjct: 74  MEHGMKTVEVAVKGPGSGREAAIRALQTTGLEVTSIKDVTPVPHNGCRPPKRRRV 128


>gi|296141064|ref|YP_003648307.1| 30S ribosomal protein S11 [Tsukamurella paurometabola DSM 20162]
 gi|296029198|gb|ADG79968.1| 30S ribosomal protein S11 [Tsukamurella paurometabola DSM 20162]
          Length = 137

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 91/121 (75%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R RE+KN+  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++PFAAQ+A +
Sbjct: 17  RRREKKNVPHGHAHIKSTFNNTIVSITDPAGNVISWASSGHVGFKGSRKSTPFAAQLAAE 76

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           + + KAQ +G+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGCRP KRRR
Sbjct: 77  NAARKAQENGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGTISDVTPQPHNGCRPPKRRR 136

Query: 129 I 129
           +
Sbjct: 137 V 137


>gi|209527119|ref|ZP_03275633.1| ribosomal protein S11 [Arthrospira maxima CS-328]
 gi|284053325|ref|ZP_06383535.1| 30S ribosomal protein S11 [Arthrospira platensis str. Paraca]
 gi|209492459|gb|EDZ92800.1| ribosomal protein S11 [Arthrospira maxima CS-328]
 gi|291567807|dbj|BAI90079.1| 30S ribosomal protein S11 [Arthrospira platensis NIES-39]
          Length = 130

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/119 (48%), Positives = 84/119 (70%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           ++++N+ +G A++ STFNNT ++ITD +G  I+W+S    GF G++K +PFAAQ A +  
Sbjct: 12  KQKRNVPNGVAYIQSTFNNTIVSITDQNGEVISWASAGSTGFKGAKKGTPFAAQTAAESA 71

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             +A + GM  +EV VSG G+GR++A+RAL+  G  I  I DVT I HNGCRP KRRR+
Sbjct: 72  GRRASDQGMRQIEVMVSGPGSGRETAIRALQGAGLEITLIRDVTPIPHNGCRPPKRRRV 130


>gi|116493138|ref|YP_804873.1| 30S ribosomal protein S11 [Pediococcus pentosaceus ATCC 25745]
 gi|122265398|sp|Q03EE1|RS11_PEDPA RecName: Full=30S ribosomal protein S11
 gi|116103288|gb|ABJ68431.1| SSU ribosomal protein S11P [Pediococcus pentosaceus ATCC 25745]
          Length = 129

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI SG AH+ STFNNT + ITDP GN +AWSS   +GF GSRK++PFAAQ+A++
Sbjct: 9   KRRVKKNIESGVAHIHSTFNNTLVMITDPQGNAVAWSSAGALGFKGSRKSTPFAAQMASE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HGM ++EV V G G+GR++A+RAL+A G  + +I DVT + HNG RP KRRR
Sbjct: 69  AAAKAAMEHGMKNVEVAVKGPGSGREAAIRALQATGLEVSAIRDVTPVPHNGSRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|225574731|ref|ZP_03783341.1| hypothetical protein RUMHYD_02808 [Blautia hydrogenotrophica DSM
           10507]
 gi|225038060|gb|EEG48306.1| hypothetical protein RUMHYD_02808 [Blautia hydrogenotrophica DSM
           10507]
          Length = 130

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 85/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GSRK++P+AAQ+A +  +  A
Sbjct: 16  NVERGQAHIQSSFNNTIVTLTDTEGNALSWASAGGLGFKGSRKSTPYAAQMAAETATKAA 75

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ +++V V G G+GR++A+RAL+A G  + SI DVT + HNGCRP KRRR+
Sbjct: 76  LIHGLKTVDVMVKGPGSGREAAIRALQACGLEVTSIRDVTPVPHNGCRPPKRRRV 130


>gi|169350820|ref|ZP_02867758.1| hypothetical protein CLOSPI_01594 [Clostridium spiroforme DSM 1552]
 gi|169292406|gb|EDS74539.1| hypothetical protein CLOSPI_01594 [Clostridium spiroforme DSM 1552]
          Length = 130

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/122 (55%), Positives = 88/122 (72%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R + R +KNI  G AHV STFNNT +TITD HGN + WSS   +GF GSRK++PFAAQ+A
Sbjct: 8   RGKKRVKKNIAKGVAHVHSTFNNTIVTITDEHGNVLTWSSAGALGFKGSRKSTPFAAQMA 67

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
           ++  +  + +HG+ S+EV V G G GR++A+RAL+A G  + SI DVT I HNGCRP KR
Sbjct: 68  SEAAAKASMDHGVKSVEVCVKGPGPGREAAVRALQAAGLEVTSINDVTPIPHNGCRPPKR 127

Query: 127 RR 128
            R
Sbjct: 128 PR 129


>gi|120553675|ref|YP_958026.1| 30S ribosomal protein S11 [Marinobacter aquaeolei VT8]
 gi|149376661|ref|ZP_01894420.1| Ribosomal protein S11 [Marinobacter algicola DG893]
 gi|152060789|sp|A1TYM0|RS11_MARAV RecName: Full=30S ribosomal protein S11
 gi|120323524|gb|ABM17839.1| SSU ribosomal protein S11P [Marinobacter aquaeolei VT8]
 gi|149359034|gb|EDM47499.1| Ribosomal protein S11 [Marinobacter algicola DG893]
          Length = 129

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 63/129 (48%), Positives = 90/129 (69%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R R + +K +V G AH+ ++FNNT +TI+D  GN ++W++    GF GSRK++P
Sbjct: 1   MAKPGTRTRKKVKKTVVDGVAHIHASFNNTIVTISDRQGNVLSWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     A  +G+ +L+V+V G G GR+SA+RAL A G+ I +I DVT I HNG
Sbjct: 61  FAAQVAAERAGNAAAEYGLKNLDVEVKGPGPGRESAVRALNACGYKITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|116667420|pdb|2GY9|K Chain K, Structure Of The 30s Subunit Of A Pre-Translocational E.
           Coli Ribosome Obtained By Fitting Atomic Models For Rna
           And Protein Components Into Cryo-Em Map Emd-1056
 gi|116667472|pdb|2GYB|K Chain K, Structure Of The 30s Subunit Of A Secm-Stalled E. Coli
           Ribosome Complex Obtained By Fitting Atomic Models For
           Rna And Protein Components Into Cryo-Em Map Emd-1143
          Length = 116

 Score =  127 bits (320), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 81/116 (69%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++PFAAQVA + C+ 
Sbjct: 1   RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCAD 60

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNGCRP K+RR
Sbjct: 61  AVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRR 116


>gi|303240946|ref|ZP_07327457.1| 30S ribosomal protein S11 [Acetivibrio cellulolyticus CD2]
 gi|302591532|gb|EFL61269.1| 30S ribosomal protein S11 [Acetivibrio cellulolyticus CD2]
          Length = 135

 Score =  127 bits (320), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 92/127 (72%), Gaps = 1/127 (0%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K P+R R +ERKNI  G AH+ STFNNT +T+TD  GN ++WSS   +GF GSRK++PFA
Sbjct: 10  KRPTRKR-KERKNIERGAAHIRSTFNNTIVTLTDVSGNALSWSSAGALGFRGSRKSTPFA 68

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  +  A  HG+ ++EV V G G+GR++A+RAL+A G  +  I DVT I HNGCR
Sbjct: 69  AQMAAETAAKAAMEHGLKTVEVYVKGPGSGREAAIRALQAAGLEVSLIKDVTPIPHNGCR 128

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 129 PPKRRRV 135


>gi|320352937|ref|YP_004194276.1| 30S ribosomal protein S11P [Desulfobulbus propionicus DSM 2032]
 gi|320121439|gb|ADW16985.1| SSU ribosomal protein S11P [Desulfobulbus propionicus DSM 2032]
          Length = 132

 Score =  127 bits (320), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 80/115 (69%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G   + STFNNT +TI+D  GN ++WSS  V+GF GSRK++PFAAQ A +D   KA
Sbjct: 18  NVTEGIIFIYSTFNNTVVTISDRQGNALSWSSAGVLGFKGSRKSTPFAAQNALNDAVLKA 77

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + HG+  +EV+V G G GR++ALRAL  +   +  I DVT + HNGC+P KRRR+
Sbjct: 78  KEHGLRKVEVRVKGPGPGREAALRALTTVDLDVSRIVDVTPLPHNGCKPPKRRRV 132


>gi|270291109|ref|ZP_06197332.1| 30S ribosomal protein S11 [Pediococcus acidilactici 7_4]
 gi|304385389|ref|ZP_07367734.1| 30S ribosomal protein S11 [Pediococcus acidilactici DSM 20284]
 gi|270280505|gb|EFA26340.1| 30S ribosomal protein S11 [Pediococcus acidilactici 7_4]
 gi|304328596|gb|EFL95817.1| 30S ribosomal protein S11 [Pediococcus acidilactici DSM 20284]
          Length = 129

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI SG AH+ STFNNT + ITDP GN +AWSS   +GF GSRK++PFAAQ+A++
Sbjct: 9   KRRVKKNIESGVAHIHSTFNNTLVMITDPQGNAVAWSSAGALGFKGSRKSTPFAAQMASE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HGM ++EV V G G+GR++A+RAL+A G  + +I DVT + HNG RP KRRR
Sbjct: 69  AAAKAAMEHGMKNVEVAVKGPGSGREAAIRALQATGLEVSAIRDVTPVPHNGSRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|160941044|ref|ZP_02088382.1| hypothetical protein CLOBOL_05937 [Clostridium bolteae ATCC
           BAA-613]
 gi|158435993|gb|EDP13760.1| hypothetical protein CLOBOL_05937 [Clostridium bolteae ATCC
           BAA-613]
          Length = 134

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 83/111 (74%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GSRK++P+AAQ+A +  +  A  HG
Sbjct: 24  GQAHIQSSFNNTIVTLTDAQGNALSWASAGGLGFRGSRKSTPYAAQMAAETATKAALVHG 83

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + S++V V G G+GR++A+RAL+A G  + SI DVT + HNGCRP KRRR+
Sbjct: 84  LKSVDVMVKGPGSGREAAIRALQACGLEVTSIKDVTPVPHNGCRPPKRRRV 134


>gi|262197164|ref|YP_003268373.1| 30S ribosomal protein S11 [Haliangium ochraceum DSM 14365]
 gi|262080511|gb|ACY16480.1| 30S ribosomal protein S11 [Haliangium ochraceum DSM 14365]
          Length = 129

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 92/129 (71%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +   + + + RKNI SG AH+ +TFNNT ++ITD  GN ++WSS    GF GSRK++P
Sbjct: 1   MAQPKRQTKKKVRKNIQSGIAHITATFNNTIVSITDVSGNVVSWSSSGSCGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +D + KA +HGM ++ V V G GAGR+SALR L + GF I  I DVT + HNG
Sbjct: 61  FAAQLAAEDAAKKAMDHGMRNIVVFVKGPGAGRESALRGLHSAGFKINLIRDVTPVPHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRR+
Sbjct: 121 CRPRKRRRV 129


>gi|254785102|ref|YP_003072530.1| 30S ribosomal protein S11 [Teredinibacter turnerae T7901]
 gi|259494636|sp|C5BQ84|RS11_TERTT RecName: Full=30S ribosomal protein S11
 gi|237685746|gb|ACR13010.1| ribosomal protein S11 [Teredinibacter turnerae T7901]
          Length = 130

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 82/111 (73%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G AH+ ++FNNT +TITD  GNT++W++    GF GSRK++PFAAQVA +     AQ +G
Sbjct: 20  GIAHIHASFNNTIVTITDRQGNTLSWATAGGSGFRGSRKSTPFAAQVAAERAGQAAQEYG 79

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + +L+V+V G G GR+SA+RAL  +G+ I +I DVT I HNGCRP K+RR+
Sbjct: 80  LKNLDVEVKGPGPGRESAVRALNNVGYKITNITDVTPIPHNGCRPPKKRRV 130


>gi|291562746|emb|CBL41562.1| SSU ribosomal protein S11P [butyrate-producing bacterium SS3/4]
          Length = 133

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 83/111 (74%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GSRK++P+AAQ+A +  +  A  HG
Sbjct: 23  GQAHIQSSFNNTIVTLTDAQGNALSWASAGGLGFRGSRKSTPYAAQMAAETATKAALVHG 82

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + S++V V G G+GR++A+RAL+A G  + SI DVT + HNGCRP KRRR+
Sbjct: 83  LKSVDVMVKGPGSGREAAIRALQACGLEVTSIKDVTPVPHNGCRPPKRRRV 133


>gi|257054496|ref|YP_003132328.1| 30S ribosomal protein S11P [Saccharomonospora viridis DSM 43017]
 gi|256584368|gb|ACU95501.1| SSU ribosomal protein S11P [Saccharomonospora viridis DSM 43017]
          Length = 135

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 93/123 (75%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +E+KN+V G AH+ STFNNT ++ITDP+G  I+W+S   VGF GSRK++PFAAQ+A
Sbjct: 13  KVRRKEKKNVVHGHAHIKSTFNNTIVSITDPNGAVISWASSGHVGFKGSRKSTPFAAQMA 72

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            ++ + KA  HGM  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGCRP KR
Sbjct: 73  AENAARKAAEHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVGTIQDVTPQPHNGCRPPKR 132

Query: 127 RRI 129
           RR+
Sbjct: 133 RRV 135


>gi|225175648|ref|ZP_03729642.1| ribosomal protein S11 [Dethiobacter alkaliphilus AHT 1]
 gi|225168977|gb|EEG77777.1| ribosomal protein S11 [Dethiobacter alkaliphilus AHT 1]
          Length = 131

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 68/118 (57%), Positives = 87/118 (73%)

Query: 12  ERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCS 71
           ERKNI  G AH+ STFNNT ITI+D  GNTI+W+S   VGF GSRK++PFAAQ+A D+ +
Sbjct: 14  ERKNIQHGVAHIFSTFNNTHITISDLQGNTISWASAGAVGFKGSRKSTPFAAQMAADNAA 73

Query: 72  AKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             A  HG+  +EV V G G+GR++A+R+L+A G  +  I DVT I HNGCRP KRRR+
Sbjct: 74  KAAMEHGLKEVEVFVKGPGSGREAAIRSLQAAGLEVNLIKDVTPIPHNGCRPPKRRRV 131


>gi|119899682|ref|YP_934895.1| 30S ribosomal protein S11 [Azoarcus sp. BH72]
 gi|152060574|sp|A1KB03|RS11_AZOSB RecName: Full=30S ribosomal protein S11
 gi|119672095|emb|CAL96009.1| 30S ribosomal protein S11 [Azoarcus sp. BH72]
          Length = 129

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 92/129 (71%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+ +++R + +KN+  G AHV ++FNNT ITITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKTATKVRKKIKKNVAEGIAHVHASFNNTIITITDRQGNALSWATSGGAGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     AQ  G+ +LEV++ G G GR+SA+RAL A+G  I SI D+T I HNG
Sbjct: 61  FAAQVAAEAAGKVAQECGVKNLEVRIKGPGPGRESAVRALNALGMKISSITDITPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RRI
Sbjct: 121 CRPPKKRRI 129


>gi|323483274|ref|ZP_08088664.1| ribosomal protein S11 [Clostridium symbiosum WAL-14163]
 gi|323691227|ref|ZP_08105503.1| ribosomal protein S11 [Clostridium symbiosum WAL-14673]
 gi|323403372|gb|EGA95680.1| ribosomal protein S11 [Clostridium symbiosum WAL-14163]
 gi|323504746|gb|EGB20532.1| ribosomal protein S11 [Clostridium symbiosum WAL-14673]
          Length = 133

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 83/111 (74%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GSRK++P+AAQ+A +  +  A  HG
Sbjct: 23  GQAHIQSSFNNTIVTLTDAQGNALSWASAGGLGFRGSRKSTPYAAQMAAETATKAALIHG 82

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + S++V V G G+GR++A+RAL+A G  + SI DVT + HNGCRP KRRR+
Sbjct: 83  LKSVDVMVKGPGSGREAAIRALQACGLEVTSIKDVTPVPHNGCRPPKRRRV 133


>gi|238018649|ref|ZP_04599075.1| hypothetical protein VEIDISOL_00484 [Veillonella dispar ATCC 17748]
 gi|269798524|ref|YP_003312424.1| ribosomal protein S11 [Veillonella parvula DSM 2008]
 gi|282849890|ref|ZP_06259273.1| 30S ribosomal protein S11 [Veillonella parvula ATCC 17745]
 gi|294792820|ref|ZP_06757967.1| 30S ribosomal protein S11 [Veillonella sp. 6_1_27]
 gi|294794574|ref|ZP_06759710.1| 30S ribosomal protein S11 [Veillonella sp. 3_1_44]
 gi|303230132|ref|ZP_07316901.1| 30S ribosomal protein S11 [Veillonella atypica ACS-134-V-Col7a]
 gi|303231253|ref|ZP_07317991.1| 30S ribosomal protein S11 [Veillonella atypica ACS-049-V-Sch6]
 gi|313893001|ref|ZP_07826578.1| 30S ribosomal protein S11 [Veillonella sp. oral taxon 158 str.
           F0412]
 gi|237865120|gb|EEP66410.1| hypothetical protein VEIDISOL_00484 [Veillonella dispar ATCC 17748]
 gi|269095153|gb|ACZ25144.1| ribosomal protein S11 [Veillonella parvula DSM 2008]
 gi|282580327|gb|EFB85727.1| 30S ribosomal protein S11 [Veillonella parvula ATCC 17745]
 gi|294454904|gb|EFG23277.1| 30S ribosomal protein S11 [Veillonella sp. 3_1_44]
 gi|294456719|gb|EFG25082.1| 30S ribosomal protein S11 [Veillonella sp. 6_1_27]
 gi|302514160|gb|EFL56164.1| 30S ribosomal protein S11 [Veillonella atypica ACS-049-V-Sch6]
 gi|302515193|gb|EFL57166.1| 30S ribosomal protein S11 [Veillonella atypica ACS-134-V-Col7a]
 gi|313442354|gb|EFR60769.1| 30S ribosomal protein S11 [Veillonella sp. oral taxon 158 str.
           F0412]
          Length = 129

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 94/129 (72%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K   R + +E+K+I SG AH+ STFNNT +T+TD +GN ++W+S   +GF GSRK++P
Sbjct: 1   MAKKVVRTKRKEKKHIESGAAHIRSTFNNTIVTLTDTNGNALSWASAGGLGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  +  A  HG+ ++EV V G G+GR++A+RAL+A G  + SI DVT I HNG
Sbjct: 61  FAAQMAAEQAAKAAMEHGLRTVEVFVKGPGSGREAAIRALQAAGLEVTSIKDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|238916290|ref|YP_002929807.1| small subunit ribosomal protein S11 [Eubacterium eligens ATCC
           27750]
 gi|238871650|gb|ACR71360.1| small subunit ribosomal protein S11 [Eubacterium eligens ATCC
           27750]
          Length = 131

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 84/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GS+K++P+AAQ+A +  +  A
Sbjct: 17  NVERGQAHIQSSFNNTIVTLTDAEGNALSWASAGGLGFRGSKKSTPYAAQMAAETATKAA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ S++V V G G+GR++A+RAL A G  + SI DVT + HNGCRP KRRR+
Sbjct: 77  LIHGLKSVDVMVKGPGSGREAAIRALSAAGLEVTSIKDVTPVPHNGCRPPKRRRV 131


>gi|167755937|ref|ZP_02428064.1| hypothetical protein CLORAM_01457 [Clostridium ramosum DSM 1402]
 gi|237733254|ref|ZP_04563735.1| 30S ribosomal protein S11 [Mollicutes bacterium D7]
 gi|167703929|gb|EDS18508.1| hypothetical protein CLORAM_01457 [Clostridium ramosum DSM 1402]
 gi|229383635|gb|EEO33726.1| 30S ribosomal protein S11 [Coprobacillus sp. D7]
          Length = 130

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 67/122 (54%), Positives = 88/122 (72%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R + R +KNI  G AHV STFNNT +TITD HGN + WSS   +GF GSRK++PFAAQ+A
Sbjct: 8   RGKKRAKKNIAKGVAHVHSTFNNTIVTITDEHGNVLTWSSAGALGFKGSRKSTPFAAQMA 67

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
           ++  +  + +HG+ S+EV V G G GR++A+RAL+A G  + +I DVT I HNGCRP KR
Sbjct: 68  SEAAAKASMDHGVKSVEVCVKGPGPGREAAVRALQAAGLEVTAINDVTPIPHNGCRPPKR 127

Query: 127 RR 128
            R
Sbjct: 128 PR 129


>gi|258513666|ref|YP_003189888.1| 30S ribosomal protein S11 [Desulfotomaculum acetoxidans DSM 771]
 gi|257777371|gb|ACV61265.1| ribosomal protein S11 [Desulfotomaculum acetoxidans DSM 771]
          Length = 129

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +   R + RERKNI  G AH+ STFNNT +TI D  GN I+W+S   VGF GSRK++P
Sbjct: 1   MARRTVRTKRRERKNIEQGVAHIKSTFNNTIVTIADIKGNAISWASAGGVGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  +  A  HG+  +EV V G GAGR++A+R+L+A G  +  I DVT I HNG
Sbjct: 61  FAAQLAAETAAKAAMEHGLKEVEVMVKGPGAGREAAIRSLQAAGLEVNLIKDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|15676093|ref|NP_273224.1| 30S ribosomal protein S11 [Neisseria meningitidis MC58]
 gi|59802137|ref|YP_208849.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae FA 1090]
 gi|121634040|ref|YP_974285.1| 30S ribosomal protein S11 [Neisseria meningitidis FAM18]
 gi|161870896|ref|YP_001600071.1| 30S ribosomal protein S11 [Neisseria meningitidis 053442]
 gi|218767144|ref|YP_002341656.1| 30S ribosomal protein S11 [Neisseria meningitidis Z2491]
 gi|225076418|ref|ZP_03719617.1| hypothetical protein NEIFLAOT_01463 [Neisseria flavescens
           NRL30031/H210]
 gi|239997949|ref|ZP_04717873.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae 35/02]
 gi|240015073|ref|ZP_04721986.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae DGI18]
 gi|240017522|ref|ZP_04724062.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae FA6140]
 gi|240081665|ref|ZP_04726208.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae FA19]
 gi|240113943|ref|ZP_04728433.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae MS11]
 gi|240116677|ref|ZP_04730739.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae PID18]
 gi|240118899|ref|ZP_04732961.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae PID1]
 gi|240122145|ref|ZP_04735107.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae PID24-1]
 gi|240124437|ref|ZP_04737393.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae PID332]
 gi|240124694|ref|ZP_04737580.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae SK-92-679]
 gi|240129113|ref|ZP_04741774.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae SK-93-1035]
 gi|241759606|ref|ZP_04757707.1| 30S ribosomal protein S11 [Neisseria flavescens SK114]
 gi|254494698|ref|ZP_05107869.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae 1291]
 gi|254805790|ref|YP_003084011.1| 30S ribosomal protein S11 [Neisseria meningitidis alpha14]
 gi|255067435|ref|ZP_05319290.1| 30S ribosomal protein S11 [Neisseria sicca ATCC 29256]
 gi|260439564|ref|ZP_05793380.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae DGI2]
 gi|261364878|ref|ZP_05977761.1| 30S ribosomal protein S11 [Neisseria mucosa ATCC 25996]
 gi|261378064|ref|ZP_05982637.1| 30S ribosomal protein S11 [Neisseria cinerea ATCC 14685]
 gi|261380582|ref|ZP_05985155.1| 30S ribosomal protein S11 [Neisseria subflava NJ9703]
 gi|268593799|ref|ZP_06127966.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae 35/02]
 gi|268597762|ref|ZP_06131929.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae FA19]
 gi|268600007|ref|ZP_06134174.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae MS11]
 gi|268602344|ref|ZP_06136511.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae PID18]
 gi|268604608|ref|ZP_06138775.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae PID1]
 gi|268683065|ref|ZP_06149927.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae PID332]
 gi|268683268|ref|ZP_06150130.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae SK-92-679]
 gi|268687495|ref|ZP_06154357.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae SK-93-1035]
 gi|291042800|ref|ZP_06568541.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae DGI2]
 gi|293398179|ref|ZP_06642384.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae F62]
 gi|294789217|ref|ZP_06754456.1| 30S ribosomal protein S11 [Simonsiella muelleri ATCC 29453]
 gi|296313388|ref|ZP_06863329.1| 30S ribosomal protein S11 [Neisseria polysaccharea ATCC 43768]
 gi|298370568|ref|ZP_06981883.1| 30S ribosomal protein S11 [Neisseria sp. oral taxon 014 str. F0314]
 gi|313667464|ref|YP_004047748.1| 30S ribosomal protein S11 [Neisseria lactamica ST-640]
 gi|319639572|ref|ZP_07994319.1| 30S ribosomal protein S11 [Neisseria mucosa C102]
 gi|54039332|sp|P66355|RS11_NEIMB RecName: Full=30S ribosomal protein S11
 gi|54042109|sp|P66354|RS11_NEIMA RecName: Full=30S ribosomal protein S11
 gi|75355452|sp|Q5F5V0|RS11_NEIG1 RecName: Full=30S ribosomal protein S11
 gi|152060800|sp|A1KRJ7|RS11_NEIMF RecName: Full=30S ribosomal protein S11
 gi|189040423|sp|A9M3U2|RS11_NEIM0 RecName: Full=30S ribosomal protein S11
 gi|7225384|gb|AAF40623.1| 30S ribosomal protein S11 [Neisseria meningitidis MC58]
 gi|59719032|gb|AAW90437.1| putative 30S ribosomal protein S11 [Neisseria gonorrhoeae FA 1090]
 gi|120865746|emb|CAM09475.1| 30S ribosomal protein S11 [Neisseria meningitidis FAM18]
 gi|121051152|emb|CAM07423.1| 30S ribosomal protein S11 [Neisseria meningitidis Z2491]
 gi|161596449|gb|ABX74109.1| 30S ribosomal protein S11 [Neisseria meningitidis 053442]
 gi|224952266|gb|EEG33475.1| hypothetical protein NEIFLAOT_01463 [Neisseria flavescens
           NRL30031/H210]
 gi|226513738|gb|EEH63083.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae 1291]
 gi|241319978|gb|EER56359.1| 30S ribosomal protein S11 [Neisseria flavescens SK114]
 gi|254669332|emb|CBA08375.1| 30S ribosomal protein S11 [Neisseria meningitidis alpha14]
 gi|254670761|emb|CBA07033.1| 30S ribosomal protein S11 [Neisseria meningitidis alpha153]
 gi|254672691|emb|CBA06585.1| 30S ribosomal protein S11 [Neisseria meningitidis alpha275]
 gi|255048230|gb|EET43694.1| 30S ribosomal protein S11 [Neisseria sicca ATCC 29256]
 gi|261391702|emb|CAX49151.1| 30S ribosomal protein S11 [Neisseria meningitidis 8013]
 gi|268547188|gb|EEZ42606.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae 35/02]
 gi|268551550|gb|EEZ46569.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae FA19]
 gi|268584138|gb|EEZ48814.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae MS11]
 gi|268586475|gb|EEZ51151.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae PID18]
 gi|268588739|gb|EEZ53415.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae PID1]
 gi|268623349|gb|EEZ55749.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae PID332]
 gi|268623552|gb|EEZ55952.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae SK-92-679]
 gi|268627779|gb|EEZ60179.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae SK-93-1035]
 gi|269145514|gb|EEZ71932.1| 30S ribosomal protein S11 [Neisseria cinerea ATCC 14685]
 gi|284796550|gb|EFC51897.1| 30S ribosomal protein S11 [Neisseria subflava NJ9703]
 gi|288566926|gb|EFC88486.1| 30S ribosomal protein S11 [Neisseria mucosa ATCC 25996]
 gi|291013234|gb|EFE05200.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae DGI2]
 gi|291611442|gb|EFF40512.1| 30S ribosomal protein S11 [Neisseria gonorrhoeae F62]
 gi|294482958|gb|EFG30646.1| 30S ribosomal protein S11 [Simonsiella muelleri ATCC 29453]
 gi|296840098|gb|EFH24036.1| 30S ribosomal protein S11 [Neisseria polysaccharea ATCC 43768]
 gi|298281178|gb|EFI22668.1| 30S ribosomal protein S11 [Neisseria sp. oral taxon 014 str. F0314]
 gi|308388382|gb|ADO30702.1| 30S ribosomal protein S11 [Neisseria meningitidis alpha710]
 gi|309379136|emb|CBX22267.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313004926|emb|CBN86352.1| 30S ribosomal protein S11 [Neisseria lactamica 020-06]
 gi|317399143|gb|EFV79817.1| 30S ribosomal protein S11 [Neisseria mucosa C102]
 gi|319411350|emb|CBY91761.1| 30S ribosomal protein S11 [Neisseria meningitidis WUE 2594]
 gi|325129085|gb|EGC51934.1| ribosomal protein S11 [Neisseria meningitidis N1568]
 gi|325131056|gb|EGC53780.1| ribosomal protein S11 [Neisseria meningitidis OX99.30304]
 gi|325133078|gb|EGC55750.1| ribosomal protein S11 [Neisseria meningitidis M6190]
 gi|325135172|gb|EGC57798.1| ribosomal protein S11 [Neisseria meningitidis M13399]
 gi|325137224|gb|EGC59819.1| ribosomal protein S11 [Neisseria meningitidis M0579]
 gi|325139056|gb|EGC61602.1| ribosomal protein S11 [Neisseria meningitidis ES14902]
 gi|325141179|gb|EGC63679.1| ribosomal protein S11 [Neisseria meningitidis CU385]
 gi|325143256|gb|EGC65595.1| ribosomal protein S11 [Neisseria meningitidis 961-5945]
 gi|325145363|gb|EGC67640.1| ribosomal protein S11 [Neisseria meningitidis M01-240013]
 gi|325197453|gb|ADY92909.1| ribosomal protein S11 [Neisseria meningitidis G2136]
 gi|325199379|gb|ADY94834.1| ribosomal protein S11 [Neisseria meningitidis H44/76]
 gi|325202999|gb|ADY98453.1| ribosomal protein S11 [Neisseria meningitidis M01-240149]
 gi|325203286|gb|ADY98739.1| ribosomal protein S11 [Neisseria meningitidis M01-240355]
 gi|325205259|gb|ADZ00712.1| ribosomal protein S11 [Neisseria meningitidis M04-240196]
 gi|325207203|gb|ADZ02655.1| hypothetical protein NMBNZ0533_0170 [Neisseria meningitidis
           NZ-05/33]
          Length = 131

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 89/124 (71%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           SR+R + RK +  G  HV ++FNNT ITITD  GN ++W++    GF GSRK++PFAAQV
Sbjct: 8   SRVRKKVRKTVSEGIVHVHASFNNTIITITDRQGNALSWATSGGAGFKGSRKSTPFAAQV 67

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +     AQ +G+ +LEV++ G G GR+S++RAL A+GF I SI DVT + HNGCRP K
Sbjct: 68  AAEAAGKVAQEYGVKNLEVRIKGPGPGRESSVRALNALGFKITSITDVTPLPHNGCRPPK 127

Query: 126 RRRI 129
           +RRI
Sbjct: 128 KRRI 131


>gi|256830515|ref|YP_003159243.1| ribosomal protein S11 [Desulfomicrobium baculatum DSM 4028]
 gi|256579691|gb|ACU90827.1| ribosomal protein S11 [Desulfomicrobium baculatum DSM 4028]
          Length = 129

 Score =  127 bits (319), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 68/122 (55%), Positives = 87/122 (71%)

Query: 8   IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
           I+ +E++NI +G AHV STFNNT IT TDP GN I+W+S    GF GSRKN+PFAAQ A 
Sbjct: 8   IKKKEKRNIPTGIAHVNSTFNNTIITFTDPTGNVISWASSGASGFKGSRKNTPFAAQKAA 67

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
           +  + KA   GM S+ + V G G+GR+SA+RA+ A+G  +  I DVT I HNGCRP KRR
Sbjct: 68  ETAARKAMECGMRSVGILVKGPGSGRESAMRAINAVGLRVAFIRDVTPIPHNGCRPPKRR 127

Query: 128 RI 129
           R+
Sbjct: 128 RV 129


>gi|319942196|ref|ZP_08016512.1| ribosomal protein S11 [Sutterella wadsworthensis 3_1_45B]
 gi|319804249|gb|EFW01141.1| ribosomal protein S11 [Sutterella wadsworthensis 3_1_45B]
          Length = 133

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 85/124 (68%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R R + RK +  G AHV ++FNNT ITITD  GN IA SS    GF GSRK++PFAAQV
Sbjct: 10  ARGRKKVRKVVTEGIAHVHASFNNTIITITDRQGNAIAASSSGAQGFKGSRKSTPFAAQV 69

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A D     A  HG+ ++EV++ G G GR+S++RAL A+G  + SI DVT I HNG RP K
Sbjct: 70  AADVAGKIAIEHGLKNVEVRIWGPGPGRESSVRALNALGIRVTSIQDVTPIPHNGVRPSK 129

Query: 126 RRRI 129
           RRR+
Sbjct: 130 RRRV 133


>gi|255283707|ref|ZP_05348262.1| 30S ribosomal protein S11 [Bryantella formatexigens DSM 14469]
 gi|255265772|gb|EET58977.1| 30S ribosomal protein S11 [Bryantella formatexigens DSM 14469]
          Length = 131

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 85/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GSRK++P+AAQ+A +  +  A
Sbjct: 17  NVERGQAHIQSSFNNTIVTLTDAAGNALSWASAGGLGFKGSRKSTPYAAQMAAETATKAA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ +++V V G G+GR++A+RAL A G  ++SI DVT + HNGCRP KRRR+
Sbjct: 77  LVHGLKTVDVFVKGPGSGREAAIRALSACGLDVISITDVTPVPHNGCRPPKRRRV 131


>gi|313888776|ref|ZP_07822437.1| 30S ribosomal protein S11 [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845145|gb|EFR32545.1| 30S ribosomal protein S11 [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 131

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 91/124 (73%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R R R RKNI  G AH+ STFNNT +T+TD +GN I+W+S   +GF GSRK++PFAAQ 
Sbjct: 8   TRARRRVRKNIEKGEAHIASTFNNTMVTLTDINGNVISWASAGQLGFRGSRKSTPFAAQE 67

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A  + + KA+ HG+ S++V V G G+GR++A+R+L+A G  +  I DVT I HNGCRP K
Sbjct: 68  AAQEAAEKAKEHGLKSVDVYVKGPGSGREAAIRSLQASGLEVTMIKDVTPIPHNGCRPPK 127

Query: 126 RRRI 129
           RRR+
Sbjct: 128 RRRV 131


>gi|291548009|emb|CBL21117.1| SSU ribosomal protein S11P [Ruminococcus sp. SR1/5]
          Length = 130

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 85/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GSRK++P+AAQ+A +  +  A
Sbjct: 16  NVEHGQAHIQSSFNNTIVTLTDNEGNALSWASAGGLGFKGSRKSTPYAAQMAAETATKAA 75

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ +++V V G G+GR++A+RAL+A G  + SI DVT + HNGCRP KRRR+
Sbjct: 76  LIHGLKTVDVMVKGPGSGREAAIRALQACGLEVTSIRDVTPVPHNGCRPPKRRRV 130


>gi|154498911|ref|ZP_02037289.1| hypothetical protein BACCAP_02903 [Bacteroides capillosus ATCC
           29799]
 gi|150271751|gb|EDM98977.1| hypothetical protein BACCAP_02903 [Bacteroides capillosus ATCC
           29799]
          Length = 135

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 88/121 (72%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + RERKN+  G+ H+ S+FNNT +T+TD  GN ++W+S   +GF GSRK++PFAAQ A +
Sbjct: 15  KRRERKNVEKGQVHIRSSFNNTMVTVTDMGGNALSWASSGGLGFRGSRKSTPFAAQTAAE 74

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ ++EV V G GAGR++A+RAL+A+G  +  I DVT I HNGCRP KRRR
Sbjct: 75  TAAKAAMEHGLKTVEVYVKGPGAGREAAIRALQAVGLEVTLIKDVTPIPHNGCRPPKRRR 134

Query: 129 I 129
           +
Sbjct: 135 V 135


>gi|304315967|ref|YP_003851112.1| 30S ribosomal protein S11 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777469|gb|ADL68028.1| 30S ribosomal protein S11 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 130

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 92/130 (70%), Gaps = 1/130 (0%)

Query: 1   MPKSPSRI-RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           M K   RI + RERKN+  G AH+ STFNNT +T+TD  GN +AWSS   +GF GSRK++
Sbjct: 1   MAKKVKRIAKRRERKNVERGAAHIHSTFNNTIVTLTDMAGNALAWSSAGTLGFKGSRKST 60

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           P+AAQ+A +  +  A  HG+ +++V V G GAGR++A+RAL+A G  +  I DVT I HN
Sbjct: 61  PYAAQMAAETAAKAAMEHGLKTVDVYVKGPGAGREAAIRALQAAGLEVSLIKDVTPIPHN 120

Query: 120 GCRPRKRRRI 129
           GCRP KRRR+
Sbjct: 121 GCRPPKRRRV 130


>gi|327438302|dbj|BAK14667.1| ribosomal protein S11 [Solibacillus silvestris StLB046]
          Length = 129

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI SG AH+ STFNNT +TITD  GN ++WSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVKKNIESGVAHIRSTFNNTIVTITDMQGNALSWSSAGALGFRGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  +  HG+ ++EV V G G+GR++A+RAL+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TAAKTSMEHGLKNIEVTVKGPGSGREAAVRALQAAGLEVTAIKDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|296130463|ref|YP_003637713.1| 30S ribosomal protein S11 [Cellulomonas flavigena DSM 20109]
 gi|296022278|gb|ADG75514.1| 30S ribosomal protein S11 [Cellulomonas flavigena DSM 20109]
          Length = 133

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 91/121 (75%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +E+KN+  G+AH+ STFNNT ++ITDP G  IAW+S   VGF GSRK++PFAAQ+A +
Sbjct: 13  RRKEKKNVSHGQAHIKSTFNNTIVSITDPSGAVIAWASSGQVGFKGSRKSTPFAAQLAAE 72

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + +AQ HGM  ++V V G G+GR++A+R+L+A G  + SI DVT  AHNGCRP KRRR
Sbjct: 73  AAARRAQEHGMRKVDVFVKGPGSGRETAIRSLQATGLEVGSIQDVTPQAHNGCRPPKRRR 132

Query: 129 I 129
           +
Sbjct: 133 V 133


>gi|110833281|ref|YP_692140.1| 30S ribosomal protein S11 [Alcanivorax borkumensis SK2]
 gi|123345802|sp|Q0VSI0|RS11_ALCBS RecName: Full=30S ribosomal protein S11
 gi|110646392|emb|CAL15868.1| 30S ribosomal protein S11 [Alcanivorax borkumensis SK2]
          Length = 132

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 85/121 (70%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +  + +  G AHV ++FNNT ITITD  GN ++W++    GF GSRK++PFAAQVA +
Sbjct: 12  RKKVTRTVADGIAHVHASFNNTIITITDRQGNALSWATSGGAGFRGSRKSTPFAAQVAAE 71

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           +    A+++G+ +LEV+V G G GR+S++RAL   G+ I  I DVT I HNGCRP K+RR
Sbjct: 72  NAGNAAKDYGLKNLEVRVKGPGPGRESSIRALNGCGYKITHIEDVTPIPHNGCRPPKKRR 131

Query: 129 I 129
           +
Sbjct: 132 V 132


>gi|297571896|ref|YP_003697670.1| 30S ribosomal protein S11 [Arcanobacterium haemolyticum DSM 20595]
 gi|296932243|gb|ADH93051.1| 30S ribosomal protein S11 [Arcanobacterium haemolyticum DSM 20595]
          Length = 130

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 94/128 (73%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK+  R R   RKN+V+G+AH+ STFNNT ++ITDP+G  IA +S  +VGF GSRK++P+
Sbjct: 3   PKTQRRSRRTVRKNVVNGQAHIKSTFNNTIVSITDPNGEVIAQTSSGMVGFKGSRKSTPY 62

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ+A ++ + +A   GM  ++V V G G+GR++A+R+L A G  + SI DVT  AHNGC
Sbjct: 63  AAQLAAENAARRAMEAGMKKVDVFVKGPGSGRETAIRSLTASGLEVTSISDVTPQAHNGC 122

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 123 RPPKRRRV 130


>gi|77165765|ref|YP_344290.1| 30S ribosomal protein S11 [Nitrosococcus oceani ATCC 19707]
 gi|91207662|sp|Q3J8T6|RS11_NITOC RecName: Full=30S ribosomal protein S11
 gi|76884079|gb|ABA58760.1| SSU ribosomal protein S11P [Nitrosococcus oceani ATCC 19707]
          Length = 127

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 84/121 (69%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R ++ +  G AH+ ++FNNT +TITD  GNT+AW++    GF GSRK++PFAAQVA +
Sbjct: 7   KKRVKRVVSDGIAHIHASFNNTIVTITDRQGNTLAWATSGGSGFRGSRKSTPFAAQVAAE 66

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
                 Q  GM +LEV+V G G GR+SA R+L  +GF + +I D+T I HNGCRP K+RR
Sbjct: 67  KAGRIVQEMGMKNLEVRVKGPGPGRESAARSLNNVGFKVTNIADITPIPHNGCRPPKKRR 126

Query: 129 I 129
           +
Sbjct: 127 V 127


>gi|303256473|ref|ZP_07342487.1| 30S ribosomal protein S11 [Burkholderiales bacterium 1_1_47]
 gi|331000667|ref|ZP_08324320.1| 30S ribosomal protein S11 [Parasutterella excrementihominis YIT
           11859]
 gi|302859964|gb|EFL83041.1| 30S ribosomal protein S11 [Burkholderiales bacterium 1_1_47]
 gi|329570879|gb|EGG52590.1| 30S ribosomal protein S11 [Parasutterella excrementihominis YIT
           11859]
          Length = 137

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 85/123 (69%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R R + +K +  G AHV ++FNNT ITITD  GN IA SS    GF GSRK++PFAAQVA
Sbjct: 15  RARRKVKKVVTEGIAHVHASFNNTIITITDRQGNAIAASSSGAQGFKGSRKSTPFAAQVA 74

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +     A  +G+ ++EV+++G G GR+S++RAL A+G  + SI DVT + HNG RP KR
Sbjct: 75  AEQAGRHALEYGLKNVEVRITGPGPGRESSVRALNALGIRVTSIQDVTPVPHNGVRPSKR 134

Query: 127 RRI 129
           RR+
Sbjct: 135 RRV 137


>gi|90020629|ref|YP_526456.1| 30S ribosomal protein S11 [Saccharophagus degradans 2-40]
 gi|123277584|sp|Q21M35|RS11_SACD2 RecName: Full=30S ribosomal protein S11
 gi|89950229|gb|ABD80244.1| SSU ribosomal protein S11P / histidine kinase [Saccharophagus
           degradans 2-40]
          Length = 131

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 83/111 (74%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G AH+ ++FNNT +TITD  GNT++W++    GF GSRK++PFAAQVA +     AQ++G
Sbjct: 21  GIAHIHASFNNTIVTITDRQGNTLSWATAGGSGFRGSRKSTPFAAQVAAERAGQAAQDYG 80

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + +L+V+V G G GR+SA+RAL  IG+ + +I DVT I HNGCRP K+RR+
Sbjct: 81  LKNLDVEVKGPGPGRESAVRALNNIGYKVNNITDVTPIPHNGCRPPKKRRV 131


>gi|291087196|ref|ZP_06345680.2| 30S ribosomal protein S11 [Clostridium sp. M62/1]
 gi|291075941|gb|EFE13305.1| 30S ribosomal protein S11 [Clostridium sp. M62/1]
          Length = 133

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 83/111 (74%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GSRK++P+AAQ+A +  +  A  HG
Sbjct: 23  GQAHIQSSFNNTIVTLTDAQGNALSWASAGGLGFRGSRKSTPYAAQMAAETATKAALIHG 82

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + S++V V G G+GR++A+RAL+A G  + SI DVT + HNGCRP KRRR+
Sbjct: 83  LKSVDVMVKGPGSGREAAIRALQACGLEVTSIRDVTPVPHNGCRPPKRRRV 133


>gi|72163018|ref|YP_290675.1| 30S ribosomal protein S11 [Thermobifida fusca YX]
 gi|91207683|sp|Q47LM0|RS11_THEFY RecName: Full=30S ribosomal protein S11
 gi|71916750|gb|AAZ56652.1| SSU ribosomal protein S11P [Thermobifida fusca YX]
          Length = 134

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 93/123 (75%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +E+KN+V G AH+ STFNNT ++ITDP G  I+W+S   VGF GSRK++PFAAQ+A
Sbjct: 12  KVRRKEKKNVVHGHAHIKSTFNNTIVSITDPTGAVISWASAGQVGFKGSRKSTPFAAQMA 71

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +AQ HG+  ++V V G G+GR++A+R+L+A G  + SI DVT + HNGCRP KR
Sbjct: 72  AEAAARRAQEHGVRKVDVFVKGPGSGRETAIRSLQATGLEVGSIQDVTPVPHNGCRPPKR 131

Query: 127 RRI 129
           RR+
Sbjct: 132 RRV 134


>gi|65317582|ref|ZP_00390541.1| COG0100: Ribosomal protein S11 [Bacillus anthracis str. A2012]
          Length = 129

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 65/119 (54%), Positives = 88/119 (73%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           R +KNI +G AH+ STFNNT +T+TD HGN ++WSS   +GF GSRK++PFAAQ+A +  
Sbjct: 11  RVKKNIEAGVAHIRSTFNNTIVTLTDTHGNALSWSSAGALGFRGSRKSTPFAAQMAAETA 70

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +  A  HG+ +L V V G GAGR++A+RAL+A G  + +I DVT + HNGCRP KRRR+
Sbjct: 71  AKAAMEHGLKTLXVTVKGPGAGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRRV 129


>gi|15674312|ref|NP_268485.1| 30S ribosomal protein S11 [Streptococcus pyogenes M1 GAS]
 gi|71909883|ref|YP_281433.1| 30S ribosomal protein S11 [Streptococcus pyogenes MGAS5005]
 gi|48474623|sp|Q9A1V0|RS11_STRP1 RecName: Full=30S ribosomal protein S11
 gi|13621393|gb|AAK33207.1| 30S ribosomal protein S11 [Streptococcus pyogenes M1 GAS]
 gi|71852665|gb|AAZ50688.1| SSU ribosomal protein S11P [Streptococcus pyogenes MGAS5005]
          Length = 127

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 91/125 (72%), Gaps = 1/125 (0%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P+R R R +K+I SG AH+ +TFNNT + ITD HGN +AWSS   +GF GSRK++PFAAQ
Sbjct: 4   PTRKR-RVKKDIESGVAHIHATFNNTIVMITDVHGNALAWSSAGALGFKGSRKSTPFAAQ 62

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           +A +  +  AQ HG+ ++EV V G G+GR+SA+RAL A G  + +I DVT + HNG RP 
Sbjct: 63  MAAEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLEVTAIRDVTPVPHNGARPP 122

Query: 125 KRRRI 129
           KRRR+
Sbjct: 123 KRRRV 127


>gi|29374876|ref|NP_814029.1| 30S ribosomal protein S11 [Enterococcus faecalis V583]
 gi|227520017|ref|ZP_03950066.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0104]
 gi|227555878|ref|ZP_03985925.1| 30S ribosomal protein S11 [Enterococcus faecalis HH22]
 gi|229546939|ref|ZP_04435664.1| 30S ribosomal protein S11 [Enterococcus faecalis TX1322]
 gi|229550528|ref|ZP_04439253.1| 30S ribosomal protein S11 [Enterococcus faecalis ATCC 29200]
 gi|255971734|ref|ZP_05422320.1| ribosomal protein S11 [Enterococcus faecalis T1]
 gi|255974734|ref|ZP_05425320.1| ribosomal protein S11 [Enterococcus faecalis T2]
 gi|256618355|ref|ZP_05475201.1| ribosomal protein S11 [Enterococcus faecalis ATCC 4200]
 gi|256762029|ref|ZP_05502609.1| ribosomal protein S11 [Enterococcus faecalis T3]
 gi|256855188|ref|ZP_05560549.1| ribosomal protein S11 [Enterococcus faecalis T8]
 gi|256956837|ref|ZP_05561008.1| ribosomal protein S11 [Enterococcus faecalis DS5]
 gi|256960644|ref|ZP_05564815.1| 30S ribosomal protein S11 [Enterococcus faecalis Merz96]
 gi|256964157|ref|ZP_05568328.1| 30S ribosomal protein S11 [Enterococcus faecalis HIP11704]
 gi|257078507|ref|ZP_05572868.1| 30S ribosomal protein S11 [Enterococcus faecalis JH1]
 gi|257081522|ref|ZP_05575883.1| ribosomal protein S11 [Enterococcus faecalis E1Sol]
 gi|257084170|ref|ZP_05578531.1| 30S ribosomal protein S11 [Enterococcus faecalis Fly1]
 gi|257087997|ref|ZP_05582358.1| ribosomal protein S11 [Enterococcus faecalis D6]
 gi|257088674|ref|ZP_05583035.1| 30S ribosomal protein S11 [Enterococcus faecalis CH188]
 gi|257417600|ref|ZP_05594594.1| ribosomal protein S11 [Enterococcus faecalis AR01/DG]
 gi|257418674|ref|ZP_05595668.1| 30S ribosomal protein S11 [Enterococcus faecalis T11]
 gi|257421524|ref|ZP_05598514.1| 30S ribosomal protein S11 [Enterococcus faecalis X98]
 gi|293382733|ref|ZP_06628658.1| 30S ribosomal protein S11 [Enterococcus faecalis R712]
 gi|293388084|ref|ZP_06632612.1| 30S ribosomal protein S11 [Enterococcus faecalis S613]
 gi|294781076|ref|ZP_06746427.1| 30S ribosomal protein S11 [Enterococcus faecalis PC1.1]
 gi|300862263|ref|ZP_07108343.1| 30S ribosomal protein S11 [Enterococcus faecalis TUSoD Ef11]
 gi|307269112|ref|ZP_07550473.1| 30S ribosomal protein S11 [Enterococcus faecalis TX4248]
 gi|307274196|ref|ZP_07555404.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0855]
 gi|307276421|ref|ZP_07557544.1| 30S ribosomal protein S11 [Enterococcus faecalis TX2134]
 gi|307278631|ref|ZP_07559701.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0860]
 gi|307286989|ref|ZP_07567064.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0109]
 gi|307291670|ref|ZP_07571545.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0411]
 gi|312901097|ref|ZP_07760385.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0470]
 gi|312904659|ref|ZP_07763814.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0635]
 gi|312908628|ref|ZP_07767570.1| 30S ribosomal protein S11 [Enterococcus faecalis DAPTO 512]
 gi|312909224|ref|ZP_07768081.1| 30S ribosomal protein S11 [Enterococcus faecalis DAPTO 516]
 gi|312952632|ref|ZP_07771496.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0102]
 gi|34925214|sp|Q839E0|RS11_ENTFA RecName: Full=30S ribosomal protein S11
 gi|29342334|gb|AAO80100.1| ribosomal protein S11 [Enterococcus faecalis V583]
 gi|227072565|gb|EEI10528.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0104]
 gi|227175045|gb|EEI56017.1| 30S ribosomal protein S11 [Enterococcus faecalis HH22]
 gi|229304247|gb|EEN70243.1| 30S ribosomal protein S11 [Enterococcus faecalis ATCC 29200]
 gi|229307867|gb|EEN73854.1| 30S ribosomal protein S11 [Enterococcus faecalis TX1322]
 gi|255962752|gb|EET95228.1| ribosomal protein S11 [Enterococcus faecalis T1]
 gi|255967606|gb|EET98228.1| ribosomal protein S11 [Enterococcus faecalis T2]
 gi|256597882|gb|EEU17058.1| ribosomal protein S11 [Enterococcus faecalis ATCC 4200]
 gi|256683280|gb|EEU22975.1| ribosomal protein S11 [Enterococcus faecalis T3]
 gi|256709701|gb|EEU24748.1| ribosomal protein S11 [Enterococcus faecalis T8]
 gi|256947333|gb|EEU63965.1| ribosomal protein S11 [Enterococcus faecalis DS5]
 gi|256951140|gb|EEU67772.1| 30S ribosomal protein S11 [Enterococcus faecalis Merz96]
 gi|256954653|gb|EEU71285.1| 30S ribosomal protein S11 [Enterococcus faecalis HIP11704]
 gi|256986537|gb|EEU73839.1| 30S ribosomal protein S11 [Enterococcus faecalis JH1]
 gi|256989552|gb|EEU76854.1| ribosomal protein S11 [Enterococcus faecalis E1Sol]
 gi|256992200|gb|EEU79502.1| 30S ribosomal protein S11 [Enterococcus faecalis Fly1]
 gi|256996027|gb|EEU83329.1| ribosomal protein S11 [Enterococcus faecalis D6]
 gi|256997486|gb|EEU84006.1| 30S ribosomal protein S11 [Enterococcus faecalis CH188]
 gi|257159428|gb|EEU89388.1| ribosomal protein S11 [Enterococcus faecalis ARO1/DG]
 gi|257160502|gb|EEU90462.1| 30S ribosomal protein S11 [Enterococcus faecalis T11]
 gi|257163348|gb|EEU93308.1| 30S ribosomal protein S11 [Enterococcus faecalis X98]
 gi|291079893|gb|EFE17257.1| 30S ribosomal protein S11 [Enterococcus faecalis R712]
 gi|291082535|gb|EFE19498.1| 30S ribosomal protein S11 [Enterococcus faecalis S613]
 gi|294451879|gb|EFG20330.1| 30S ribosomal protein S11 [Enterococcus faecalis PC1.1]
 gi|295112523|emb|CBL31160.1| SSU ribosomal protein S11P [Enterococcus sp. 7L76]
 gi|300848788|gb|EFK76545.1| 30S ribosomal protein S11 [Enterococcus faecalis TUSoD Ef11]
 gi|306497289|gb|EFM66831.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0411]
 gi|306501935|gb|EFM71224.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0109]
 gi|306504691|gb|EFM73891.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0860]
 gi|306506901|gb|EFM76048.1| 30S ribosomal protein S11 [Enterococcus faecalis TX2134]
 gi|306509158|gb|EFM78220.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0855]
 gi|306514592|gb|EFM83146.1| 30S ribosomal protein S11 [Enterococcus faecalis TX4248]
 gi|310625415|gb|EFQ08698.1| 30S ribosomal protein S11 [Enterococcus faecalis DAPTO 512]
 gi|310629420|gb|EFQ12703.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0102]
 gi|310632011|gb|EFQ15294.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0635]
 gi|311290466|gb|EFQ69022.1| 30S ribosomal protein S11 [Enterococcus faecalis DAPTO 516]
 gi|311291769|gb|EFQ70325.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0470]
 gi|315026810|gb|EFT38742.1| 30S ribosomal protein S11 [Enterococcus faecalis TX2137]
 gi|315028851|gb|EFT40783.1| 30S ribosomal protein S11 [Enterococcus faecalis TX4000]
 gi|315031164|gb|EFT43096.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0017]
 gi|315035990|gb|EFT47922.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0027]
 gi|315145361|gb|EFT89377.1| 30S ribosomal protein S11 [Enterococcus faecalis TX2141]
 gi|315147146|gb|EFT91162.1| 30S ribosomal protein S11 [Enterococcus faecalis TX4244]
 gi|315151096|gb|EFT95112.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0012]
 gi|315153584|gb|EFT97600.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0031]
 gi|315156236|gb|EFU00253.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0043]
 gi|315158619|gb|EFU02636.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0312]
 gi|315160752|gb|EFU04769.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0645]
 gi|315165877|gb|EFU09894.1| 30S ribosomal protein S11 [Enterococcus faecalis TX1302]
 gi|315168125|gb|EFU12142.1| 30S ribosomal protein S11 [Enterococcus faecalis TX1341]
 gi|315171435|gb|EFU15452.1| 30S ribosomal protein S11 [Enterococcus faecalis TX1342]
 gi|315573539|gb|EFU85730.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0309B]
 gi|315579351|gb|EFU91542.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0630]
 gi|315582113|gb|EFU94304.1| 30S ribosomal protein S11 [Enterococcus faecalis TX0309A]
 gi|323479447|gb|ADX78886.1| 30S ribosomal protein S11 [Enterococcus faecalis 62]
 gi|327534029|gb|AEA92863.1| 30S ribosomal protein S11 [Enterococcus faecalis OG1RF]
          Length = 129

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI SG AH+ STFNNT + ITD HGN +AWSS   +GF GS+K++PFAAQ+A +
Sbjct: 9   KRRVKKNIESGVAHIHSTFNNTIVMITDTHGNALAWSSAGSLGFKGSKKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ +++V V G G+GR++A+R+L+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  AATKVAMEHGLKTVDVTVKGPGSGREAAIRSLQATGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|291298740|ref|YP_003510018.1| 30S ribosomal protein S11 [Stackebrandtia nassauensis DSM 44728]
 gi|290567960|gb|ADD40925.1| ribosomal protein S11 [Stackebrandtia nassauensis DSM 44728]
          Length = 132

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 92/124 (74%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +++R +E+KN+ +G AH+ STFNNT ++ITDP G  I+WSS   VGF GSRK++P+AAQ+
Sbjct: 9   TKLRRKEKKNVAAGHAHIKSTFNNTIVSITDPAGAVISWSSSGQVGFKGSRKSTPYAAQM 68

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  + +A  HGM  ++V V G G+GR++A+R+L+A G  + SI DVT   HNGCRP K
Sbjct: 69  AAEAAARRAMEHGMRKVDVFVKGPGSGRETAIRSLQAAGLEVGSISDVTPQPHNGCRPPK 128

Query: 126 RRRI 129
           RRR+
Sbjct: 129 RRRV 132


>gi|225016259|ref|ZP_03705451.1| hypothetical protein CLOSTMETH_00162 [Clostridium methylpentosum
           DSM 5476]
 gi|224950934|gb|EEG32143.1| hypothetical protein CLOSTMETH_00162 [Clostridium methylpentosum
           DSM 5476]
          Length = 132

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 86/121 (71%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R RERKNI  G  H+ STFNNT +TITD  GN ++W+S   +GF GSRK++PFAAQ A +
Sbjct: 12  RRRERKNIEKGSVHIQSTFNNTIVTITDTQGNALSWASAGGLGFRGSRKSTPFAAQTAAE 71

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ S+EV V G G+GR++A+RAL++ G  +  I DVT I HNGCRP KRRR
Sbjct: 72  TAAKAAMEHGLKSVEVFVKGPGSGREAAIRALQSAGLEVSMIKDVTPIPHNGCRPPKRRR 131

Query: 129 I 129
           +
Sbjct: 132 V 132


>gi|329118619|ref|ZP_08247323.1| 30S ribosomal protein S11 [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465354|gb|EGF11635.1| 30S ribosomal protein S11 [Neisseria bacilliformis ATCC BAA-1200]
          Length = 131

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 89/124 (71%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           SR+R + RK +  G  HV ++FNNT ITITD  GN ++W++    GF GSRK++PFAAQV
Sbjct: 8   SRVRRKVRKTVSEGIVHVHASFNNTIITITDRQGNALSWATSGGAGFKGSRKSTPFAAQV 67

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +     AQ +G+ +LEV++ G G GR+S++RAL A+GF I SI DVT + HNGCRP K
Sbjct: 68  AAEAAGKVAQEYGVKNLEVRIKGPGPGRESSVRALNALGFKITSITDVTPLPHNGCRPPK 127

Query: 126 RRRI 129
           +RRI
Sbjct: 128 KRRI 131


>gi|296131862|ref|YP_003639109.1| 30S ribosomal protein S11 [Thermincola sp. JR]
 gi|296030440|gb|ADG81208.1| 30S ribosomal protein S11 [Thermincola potens JR]
          Length = 128

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 91/123 (73%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R + +ERKN+  G AH+ STFNNT +TI+D  GN I+W+S  V+GF GSRK++PFAAQ+A
Sbjct: 6   RGKRKERKNVEQGIAHIKSTFNNTIVTISDRAGNAISWASAGVMGFKGSRKSTPFAAQMA 65

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +A +HGM  +EV V G GAGR++A+RA++A G  +  I DVT I HNGCRP KR
Sbjct: 66  AEKAAKEAMDHGMKEVEVYVKGPGAGREAAIRAIQAAGIEVNVIKDVTPIPHNGCRPPKR 125

Query: 127 RRI 129
           RR+
Sbjct: 126 RRV 128


>gi|255526605|ref|ZP_05393512.1| ribosomal protein S11 [Clostridium carboxidivorans P7]
 gi|296187294|ref|ZP_06855690.1| 30S ribosomal protein S11 [Clostridium carboxidivorans P7]
 gi|255509713|gb|EET86046.1| ribosomal protein S11 [Clostridium carboxidivorans P7]
 gi|296048165|gb|EFG87603.1| 30S ribosomal protein S11 [Clostridium carboxidivorans P7]
          Length = 132

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 81/111 (72%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G AH+ STFNN+ +TITD  GN ++W+S   +GF GSRK++PFAAQ+A +  +  A  HG
Sbjct: 22  GCAHIKSTFNNSIVTITDAVGNALSWASAGGLGFRGSRKSTPFAAQMAAETSAKAAMEHG 81

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + S+EV V G GAGR++A+R+L+A G  +  I DVT I HNGCRP KRRR+
Sbjct: 82  LKSVEVYVKGPGAGREAAIRSLQAAGLEVTLIKDVTPIPHNGCRPPKRRRV 132


>gi|152989996|ref|YP_001355718.1| 30S ribosomal protein S11 [Nitratiruptor sp. SB155-2]
 gi|166231820|sp|A6Q1K2|RS11_NITSB RecName: Full=30S ribosomal protein S11
 gi|151421857|dbj|BAF69361.1| 30S ribosomal protein S11 [Nitratiruptor sp. SB155-2]
          Length = 130

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 85/118 (72%), Gaps = 1/118 (0%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KNI  G  ++ +TFNNT +T+TD  GN IAWSS   +GF GS+K++PFAAQ A +D  A
Sbjct: 13  KKNIARGVVYINATFNNTVVTVTDEMGNVIAWSSAGSLGFKGSKKSTPFAAQQAVEDAMA 72

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAI-GFTIVSICDVTMIAHNGCRPRKRRRI 129
           KA+ HG+  + +KV G G+GRD+A++++ AI G  ++   D+T + HNGCRP KRRR+
Sbjct: 73  KAKEHGIKEVGIKVQGPGSGRDTAVKSVGAIEGIRVLFFKDITPLPHNGCRPPKRRRV 130


>gi|171778400|ref|ZP_02919579.1| hypothetical protein STRINF_00430 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282931|gb|EDT48355.1| hypothetical protein STRINF_00430 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 118

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (73%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KNI SG AH+ +TFNNT + ITD HGN I+WSS   +GF GSRK++PFAAQ+A +  + 
Sbjct: 2   KKNIESGVAHIHATFNNTIVMITDVHGNAISWSSAGALGFKGSRKSTPFAAQMAAEAAAK 61

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            AQ HG+ ++EV V G G+GR+SA+RAL A G  + SI DVT + HNG RP KRRR+
Sbjct: 62  SAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLEVTSIRDVTPVPHNGARPPKRRRV 118


>gi|254483460|ref|ZP_05096689.1| ribosomal protein S11 [marine gamma proteobacterium HTCC2148]
 gi|214036334|gb|EEB77012.1| ribosomal protein S11 [marine gamma proteobacterium HTCC2148]
          Length = 113

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 83/113 (73%)

Query: 17  VSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQN 76
           + G AHV ++FNNT +TITD  GNT++W++    GF GSRK++PFAAQVA +     A+ 
Sbjct: 1   MDGIAHVHASFNNTIVTITDRQGNTLSWATAGGSGFRGSRKSTPFAAQVAAERAGEAAKE 60

Query: 77  HGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +G+ +L+V+V G G GR+SA+RAL A G+ I +I DVT I HNGCRP K+RR+
Sbjct: 61  YGLKNLDVQVKGPGPGRESAVRALNACGYKIANITDVTPIPHNGCRPPKKRRV 113


>gi|157737264|ref|YP_001489947.1| 30S ribosomal protein S11 [Arcobacter butzleri RM4018]
 gi|315636981|ref|ZP_07892205.1| 30S ribosomal protein S11 [Arcobacter butzleri JV22]
 gi|166991575|sp|A8ETK4|RS11_ARCB4 RecName: Full=30S ribosomal protein S11
 gi|157699118|gb|ABV67278.1| 30S ribosomal protein S11 [Arcobacter butzleri RM4018]
 gi|315478811|gb|EFU69520.1| 30S ribosomal protein S11 [Arcobacter butzleri JV22]
          Length = 130

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 85/118 (72%), Gaps = 1/118 (0%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           RKNI  G  H+ ++FNNT +T+TD  GN IAWSS   +GF GS+K++PFAAQ A +D   
Sbjct: 13  RKNIADGIVHIAASFNNTMVTVTDNAGNAIAWSSAGNLGFKGSKKSTPFAAQAAVEDAMN 72

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAI-GFTIVSICDVTMIAHNGCRPRKRRRI 129
           KA  HG+ ++ +K+ G G+GRD+A++A+ ++ G  +  + DVT +AHNGCRP KRRR+
Sbjct: 73  KAMEHGIKNVGIKIQGPGSGRDTAVKAVGSMDGVRVTWLKDVTPLAHNGCRPPKRRRV 130


>gi|167748455|ref|ZP_02420582.1| hypothetical protein ANACAC_03199 [Anaerostipes caccae DSM 14662]
 gi|317472012|ref|ZP_07931344.1| 30S ribosomal protein S11 [Anaerostipes sp. 3_2_56FAA]
 gi|167652447|gb|EDR96576.1| hypothetical protein ANACAC_03199 [Anaerostipes caccae DSM 14662]
 gi|316900416|gb|EFV22398.1| 30S ribosomal protein S11 [Anaerostipes sp. 3_2_56FAA]
          Length = 130

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 56/115 (48%), Positives = 84/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GS+K++P+AAQ+A +  +  A
Sbjct: 16  NVQHGQAHIQSSFNNTIVTLTDAQGNALSWASAGGLGFRGSKKSTPYAAQMAAETATKAA 75

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ +++V V G G+GR++A+RAL A G  + SI DVT + HNGCRP KRRR+
Sbjct: 76  LVHGLKTVDVMVKGPGSGREAAIRALSAAGLEVTSIKDVTPVPHNGCRPPKRRRV 130


>gi|325921503|ref|ZP_08183358.1| SSU ribosomal protein S11P [Xanthomonas gardneri ATCC 19865]
 gi|325548050|gb|EGD19049.1| SSU ribosomal protein S11P [Xanthomonas gardneri ATCC 19865]
          Length = 130

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 60/114 (52%), Positives = 82/114 (71%)

Query: 16  IVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQ 75
           I  G AHV ++FNNT ITITD  GN ++W++    GF GSRK++PFAAQVA +     A 
Sbjct: 17  ITDGVAHVHASFNNTIITITDRQGNALSWATSGGAGFRGSRKSTPFAAQVAAEKAGRAAL 76

Query: 76  NHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           ++G+ SLEV++ G G GR+SA+R+L  +G+ I +I DVT I HNGCRP K+RR+
Sbjct: 77  DYGVKSLEVRIKGPGPGRESAVRSLNNVGYKITNIIDVTPIPHNGCRPPKKRRV 130


>gi|326383230|ref|ZP_08204918.1| 30S ribosomal protein S11 [Gordonia neofelifaecis NRRL B-59395]
 gi|326197980|gb|EGD55166.1| 30S ribosomal protein S11 [Gordonia neofelifaecis NRRL B-59395]
          Length = 135

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 91/121 (75%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R R++KN+  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++PFAAQ+A +
Sbjct: 15  RRRDKKNVPLGHAHIKSTFNNTIVSITDPEGNVISWASSGHVGFKGSRKSTPFAAQLAAE 74

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           + + KAQ +G+  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGCRP KRRR
Sbjct: 75  NAARKAQENGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGTISDVTPQPHNGCRPPKRRR 134

Query: 129 I 129
           +
Sbjct: 135 V 135


>gi|242620060|ref|YP_003002064.1| 30S ribosomal protein S11 [Aureococcus anophagefferens]
 gi|239997305|gb|ACS36828.1| 30S ribosomal protein S11 [Aureococcus anophagefferens]
          Length = 129

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           +++KNIVSG  H+ STFNNT ITITD  GNTI+WSS   VGF G+RK +PFAAQ AT+  
Sbjct: 11  KQKKNIVSGVVHINSTFNNTIITITDLAGNTISWSSAGSVGFKGARKGTPFAAQTATEAA 70

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           S  A   G+  +EV + G G+GR++++RAL  +G  IVSI D+T I HNGCRP KRRR+
Sbjct: 71  STAAMGQGLRKVEVLIRGQGSGRETSVRALEVLGLDIVSIKDITPIPHNGCRPPKRRRV 129


>gi|300782637|ref|YP_003762928.1| 30S ribosomal protein S11 [Amycolatopsis mediterranei U32]
 gi|299792151|gb|ADJ42526.1| small subunit ribosomal protein S11 [Amycolatopsis mediterranei
           U32]
          Length = 135

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 91/123 (73%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +E+KN+  G AH+ STFNNT ++ITDP G  IAW+S   VGF GSRK++PFAAQ+A
Sbjct: 13  KVRRKEKKNVAHGHAHIKSTFNNTIVSITDPTGAVIAWASSGHVGFKGSRKSTPFAAQMA 72

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            ++ + KA  HGM  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGCRP KR
Sbjct: 73  AENAARKAAEHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVGTIQDVTPQPHNGCRPPKR 132

Query: 127 RRI 129
           RR+
Sbjct: 133 RRV 135


>gi|297564064|ref|YP_003683037.1| 30S ribosomal protein S11 [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296848513|gb|ADH70531.1| 30S ribosomal protein S11 [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 134

 Score =  126 bits (317), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 93/123 (75%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +E+KNIV G AH+ STFNNT ++ITDP G  I+W+S   VGF GSRK++P+AAQ+A
Sbjct: 12  KVRRKEKKNIVHGHAHIKSTFNNTIVSITDPTGAVISWASSGQVGFKGSRKSTPYAAQMA 71

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +AQ HG+  ++V V G G+GR++A+R+L+A G  + SI DVT + HNGCRP KR
Sbjct: 72  AEAAARRAQEHGVRKVDVFVKGPGSGRETAIRSLQATGLEVGSIQDVTPVPHNGCRPPKR 131

Query: 127 RRI 129
           RR+
Sbjct: 132 RRV 134


>gi|240145851|ref|ZP_04744452.1| 30S ribosomal protein S11 [Roseburia intestinalis L1-82]
 gi|257201999|gb|EEV00284.1| 30S ribosomal protein S11 [Roseburia intestinalis L1-82]
 gi|291535454|emb|CBL08566.1| SSU ribosomal protein S11P [Roseburia intestinalis M50/1]
 gi|291537905|emb|CBL11016.1| SSU ribosomal protein S11P [Roseburia intestinalis XB6B4]
          Length = 130

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 84/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G+AH+ S+FNNT +TITD  GN ++W+S   +GF GS+K++P+AAQ+A +  +  A
Sbjct: 16  NVERGQAHIQSSFNNTIVTITDAEGNALSWASAGGLGFRGSKKSTPYAAQMAAETATKAA 75

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ +++V V G G+GR++A+RAL A G  + SI DVT + HNGCRP KRRR+
Sbjct: 76  LIHGLKTVDVMVKGPGSGREAAIRALSACGLEVTSIKDVTPVPHNGCRPPKRRRV 130


>gi|194246758|ref|YP_002004397.1| 30S ribosomal protein S11 [Candidatus Phytoplasma mali]
 gi|254811037|sp|B3R016|RS11_PHYMT RecName: Full=30S ribosomal protein S11
 gi|193807115|emb|CAP18553.1| 30S ribosomal protein S11 [Candidatus Phytoplasma mali]
          Length = 130

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 79/110 (71%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G AH+ +TFNNT +TITD  GNTI WSS   +GF GSRK++PFAAQ+A+   +  A  HG
Sbjct: 20  GIAHIHTTFNNTILTITDLQGNTITWSSAGSLGFKGSRKSTPFAAQIASSTAAKAALEHG 79

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           M  +EV + G GAGR++++R+L+A G  I SI DVT + HNGCRP KR R
Sbjct: 80  MLKVEVFIKGPGAGREASIRSLQASGLEITSIRDVTTVPHNGCRPPKRPR 129


>gi|197122364|ref|YP_002134315.1| 30S ribosomal protein S11 [Anaeromyxobacter sp. K]
 gi|220917146|ref|YP_002492450.1| ribosomal protein S11 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|196172213|gb|ACG73186.1| ribosomal protein S11 [Anaeromyxobacter sp. K]
 gi|219955000|gb|ACL65384.1| ribosomal protein S11 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 163

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 91/128 (71%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           P +P + + R +KNI +G  H+ STFNNT+ITITD  GN IAWSS    GF GSRK++PF
Sbjct: 36  PVTPKKGKKRVKKNIAAGIVHIASTFNNTQITITDVTGNVIAWSSAGARGFKGSRKSTPF 95

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQVA  D +AKA  HG+ ++ V V G GAGR+SALRAL A G  I  I DVT I HNGC
Sbjct: 96  AAQVAAGDAAAKAMEHGLKTVSVVVKGPGAGRESALRALSAAGLKITLIRDVTPIPHNGC 155

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 156 RPPKRRRV 163


>gi|258591341|emb|CBE67640.1| 30S ribosomal subunit protein S11 [NC10 bacterium 'Dutch sediment']
          Length = 136

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 70/119 (58%), Positives = 86/119 (72%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           +E KNI  G A V +TFNNT +TITD  GN IAW+S   VGF GSRK++PFAAQ A D  
Sbjct: 18  KEAKNIAHGIACVQATFNNTIVTITDVAGNVIAWASAGSVGFKGSRKSTPFAAQRAADSA 77

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + KA + GM  ++V V G GAGR++A+RAL+A G  IV+I DVT I HNGCRP KRRR+
Sbjct: 78  AQKAMSQGMKEVKVFVKGPGAGREAAIRALQAAGMEIVAIKDVTPIPHNGCRPSKRRRV 136


>gi|302524020|ref|ZP_07276362.1| 30S ribosomal protein S11 [Streptomyces sp. AA4]
 gi|302432915|gb|EFL04731.1| 30S ribosomal protein S11 [Streptomyces sp. AA4]
          Length = 134

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 91/123 (73%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +E+KN+  G AH+ STFNNT ++ITDP G  IAW+S   VGF GSRK++PFAAQ+A
Sbjct: 12  KVRRKEKKNVAHGHAHIKSTFNNTIVSITDPTGAVIAWASSGHVGFKGSRKSTPFAAQMA 71

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            ++ + KA  HGM  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGCRP KR
Sbjct: 72  AENAARKAAEHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVGTIQDVTPQPHNGCRPPKR 131

Query: 127 RRI 129
           RR+
Sbjct: 132 RRV 134


>gi|71276502|ref|ZP_00652777.1| Ribosomal protein S11 [Xylella fastidiosa Dixon]
 gi|71900587|ref|ZP_00682714.1| Ribosomal protein S11 [Xylella fastidiosa Ann-1]
 gi|170729722|ref|YP_001775155.1| 30S ribosomal protein S11 [Xylella fastidiosa M12]
 gi|226708438|sp|B0U5M1|RS11_XYLFM RecName: Full=30S ribosomal protein S11
 gi|71162679|gb|EAO12406.1| Ribosomal protein S11 [Xylella fastidiosa Dixon]
 gi|71729644|gb|EAO31748.1| Ribosomal protein S11 [Xylella fastidiosa Ann-1]
 gi|167964515|gb|ACA11525.1| 30S ribosomal protein S11 [Xylella fastidiosa M12]
          Length = 130

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 87/127 (68%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           +S  + + R ++ I  G AH+ ++FNNT +TITD  GN++ W +    GF GSRK +PFA
Sbjct: 4   QSVVKTKKRVKRVITDGVAHICASFNNTIVTITDRQGNSLFWCTSGASGFRGSRKCTPFA 63

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQVA +       ++GM SLEV+++G G GR+SA+R+L  +G+ I +I DVT I HNGCR
Sbjct: 64  AQVAAEKAGRAVLDYGMKSLEVRINGPGPGRESAVRSLSNVGYKITNIIDVTPIPHNGCR 123

Query: 123 PRKRRRI 129
           P K+RR+
Sbjct: 124 PPKKRRV 130


>gi|261884952|ref|ZP_06008991.1| 30S ribosomal protein S11 [Campylobacter fetus subsp. venerealis
           str. Azul-94]
          Length = 130

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 85/118 (72%), Gaps = 1/118 (0%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           RKNI  G  ++ +TFNNT +T+TD  GN IAWSS   +GF GS+K++P+AAQ A +D   
Sbjct: 13  RKNIAKGIVYISATFNNTMVTVTDEMGNAIAWSSAGGLGFKGSKKSTPYAAQQAVEDAMN 72

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAI-GFTIVSICDVTMIAHNGCRPRKRRRI 129
           KA+ HG+  + +KV G G+GR++A++++  + G  ++ + D+T +AHNGCRP KRRR+
Sbjct: 73  KAKEHGIKEVGIKVQGPGSGRETAVKSIGGVEGIKVLYLKDITPLAHNGCRPPKRRRV 130


>gi|34558006|ref|NP_907821.1| 30S ribosomal protein S11 [Wolinella succinogenes DSM 1740]
 gi|59798810|sp|Q7M8F5|RS11_WOLSU RecName: Full=30S ribosomal protein S11
 gi|34483724|emb|CAE10721.1| 30S RIBOSOMAL PROTEIN S11 [Wolinella succinogenes]
          Length = 131

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 88/127 (69%), Gaps = 4/127 (3%)

Query: 7   RIRNRER---KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAA 63
           ++ N++R   KNI  G  H+ +TFNNT +TITD  GN I WS+   +GF GS+K++P+AA
Sbjct: 5   KVTNKKRVVKKNIARGIIHIAATFNNTSVTITDEMGNVICWSTAGALGFKGSKKSTPYAA 64

Query: 64  QVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAI-GFTIVSICDVTMIAHNGCR 122
           Q A +D   KA+ HG+  L +KV G G+GR++A+++L +I G  ++   DVT + HNGCR
Sbjct: 65  QQAVEDAVVKAKEHGIKELGIKVQGPGSGRETAVKSLGSIEGIKVLWFKDVTPLPHNGCR 124

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 125 PPKRRRV 131


>gi|28198375|ref|NP_778689.1| 30S ribosomal protein S11 [Xylella fastidiosa Temecula1]
 gi|71901054|ref|ZP_00683164.1| Ribosomal protein S11 [Xylella fastidiosa Ann-1]
 gi|182681016|ref|YP_001829176.1| 30S ribosomal protein S11 [Xylella fastidiosa M23]
 gi|29839504|sp|P59586|RS11_XYLFT RecName: Full=30S ribosomal protein S11
 gi|226708437|sp|B2I8J1|RS11_XYLF2 RecName: Full=30S ribosomal protein S11
 gi|28056445|gb|AAO28338.1| 30S ribosomal protein S11 [Xylella fastidiosa Temecula1]
 gi|71729181|gb|EAO31302.1| Ribosomal protein S11 [Xylella fastidiosa Ann-1]
 gi|182631126|gb|ACB91902.1| ribosomal protein S11 [Xylella fastidiosa M23]
 gi|307579485|gb|ADN63454.1| 30S ribosomal protein S11 [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 130

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 87/127 (68%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           +S  + + R ++ I  G AH+ ++FNNT +TITD  GN++ W +    GF GSRK +PFA
Sbjct: 4   QSVVKTKKRVKRVITDGVAHICASFNNTIVTITDRQGNSLFWCTSGASGFRGSRKCTPFA 63

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQVA +       ++GM SLEV+++G G GR+SA+R+L  +G+ I +I DVT I HNGCR
Sbjct: 64  AQVAAEKAGRAVLDYGMKSLEVRINGPGPGRESAVRSLSNVGYKITNIIDVTPIPHNGCR 123

Query: 123 PRKRRRI 129
           P K+RR+
Sbjct: 124 PPKKRRV 130


>gi|223933081|ref|ZP_03625074.1| ribosomal protein S11 [Streptococcus suis 89/1591]
 gi|223898268|gb|EEF64636.1| ribosomal protein S11 [Streptococcus suis 89/1591]
          Length = 143

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 68/122 (55%), Positives = 89/122 (72%), Gaps = 1/122 (0%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P+R R R +KNI SG AH+ +TFNNT + ITD HGN IAWSS   +GF GSRK++PFAAQ
Sbjct: 4   PTRKR-RVKKNIESGIAHIHATFNNTIVMITDVHGNAIAWSSAGALGFKGSRKSTPFAAQ 62

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           +A++  +  AQ HG+ ++EV V G G+GR+SA+RAL A G  + +I DVT + HNG RP 
Sbjct: 63  MASEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLEVTAIRDVTPVPHNGARPP 122

Query: 125 KR 126
           KR
Sbjct: 123 KR 124


>gi|192359683|ref|YP_001981231.1| 30S ribosomal protein S11 [Cellvibrio japonicus Ueda107]
 gi|226708341|sp|B3PK60|RS11_CELJU RecName: Full=30S ribosomal protein S11
 gi|190685848|gb|ACE83526.1| ribosomal protein S11 [Cellvibrio japonicus Ueda107]
          Length = 131

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 82/113 (72%)

Query: 17  VSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQN 76
           + G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++PFAAQVA +     A+ 
Sbjct: 19  IDGVAHIHASFNNTIVTITDRQGNALAWATSGGSGFRGSRKSTPFAAQVAAERAGEAAKE 78

Query: 77  HGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +G+ +L+V+V G G GR+SA+RAL  +G+ I +I DVT I HNGCRP K+RR+
Sbjct: 79  YGLKNLDVEVKGPGPGRESAVRALNNVGYKITNITDVTPIPHNGCRPPKKRRV 131


>gi|308178107|ref|YP_003917513.1| 30S ribosomal protein S11 [Arthrobacter arilaitensis Re117]
 gi|307745570|emb|CBT76542.1| 30S ribosomal protein S11 [Arthrobacter arilaitensis Re117]
          Length = 133

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +++KNI  G+AH+ STFNNT ++ITDP G  I+W+S   VG  GSRK++P+AAQ+A +
Sbjct: 13  RRKDKKNIALGQAHIKSTFNNTIVSITDPTGAVISWASAGEVGMKGSRKSTPYAAQMAAE 72

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + +AQ HGM  ++V V G G+GR++A+R+L+A G  + SI DV+  AHNGCRP KRRR
Sbjct: 73  SAAKRAQEHGMRKVDVFVKGPGSGRETAIRSLQAAGLEVGSISDVSPSAHNGCRPSKRRR 132

Query: 129 I 129
           +
Sbjct: 133 V 133


>gi|289423666|ref|ZP_06425465.1| 30S ribosomal protein S11 [Peptostreptococcus anaerobius 653-L]
 gi|289155916|gb|EFD04582.1| 30S ribosomal protein S11 [Peptostreptococcus anaerobius 653-L]
          Length = 133

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 83/115 (72%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI  G AH+ STFNNT +T+TD HGN I+W+S   +GF GSRK +PFA+Q+A +  +  A
Sbjct: 19  NIERGHAHIQSTFNNTIVTLTDVHGNAISWASSGQLGFKGSRKATPFASQMAAETAAKAA 78

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ ++EV V G G+GR++A+RAL+A G  +  I DVT I HNGCRP KRRR+
Sbjct: 79  MEHGLKTVEVFVKGPGSGREAAIRALQATGLEVTMIKDVTPIPHNGCRPPKRRRV 133


>gi|296120768|ref|YP_003628546.1| ribosomal protein S11 [Planctomyces limnophilus DSM 3776]
 gi|296013108|gb|ADG66347.1| ribosomal protein S11 [Planctomyces limnophilus DSM 3776]
          Length = 126

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 86/121 (71%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R + R+N+  G AH+ +TFNNT +TITD +G+ + W++   VGF GSRK++PFAAQ A +
Sbjct: 6   RRKIRRNVNRGIAHIRATFNNTTVTITDANGDVLCWATAGTVGFKGSRKSTPFAAQRAAE 65

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
            C+ +A   G+  +E++V G G+GR+SA+  L+  G +I SI DVT + HNGCRP K+RR
Sbjct: 66  TCAERAAKFGVREMEIRVKGPGSGRESAITGLQGAGISIRSIEDVTPLPHNGCRPPKKRR 125

Query: 129 I 129
           +
Sbjct: 126 V 126


>gi|76798228|ref|ZP_00780478.1| ribosomal protein S11 [Streptococcus agalactiae 18RS21]
 gi|77406105|ref|ZP_00783179.1| ribosomal protein S11 [Streptococcus agalactiae H36B]
 gi|22533089|gb|AAM98991.1|AE014195_10 ribosomal protein S11 [Streptococcus agalactiae 2603V/R]
 gi|21903782|gb|AAM78672.1| 30S ribosomal protein S11 [Streptococcus pyogenes MGAS315]
 gi|76563298|gb|ABA45882.1| ribosomal protein S11 [Streptococcus agalactiae A909]
 gi|76586437|gb|EAO62945.1| ribosomal protein S11 [Streptococcus agalactiae 18RS21]
 gi|77175286|gb|EAO78081.1| ribosomal protein S11 [Streptococcus agalactiae H36B]
          Length = 118

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 86/117 (73%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KNI SG AH+ +TFNNT + ITD HGN +AWSS   +GF GSRK++PFAAQ+A +  + 
Sbjct: 2   KKNIESGVAHIHATFNNTIVMITDVHGNALAWSSAGALGFKGSRKSTPFAAQMAAEAAAK 61

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            AQ HG+ ++EV V G G+GR+SA+RAL A G  + +I DVT + HNG RP KRRR+
Sbjct: 62  SAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLEVTAIRDVTPVPHNGARPPKRRRV 118


>gi|209558652|ref|YP_002285124.1| 30S ribosomal protein S11 [Streptococcus pyogenes NZ131]
 gi|226708425|sp|B5XJ61|RS11_STRPZ RecName: Full=30S ribosomal protein S11
 gi|209539853|gb|ACI60429.1| SSU ribosomal protein S11p (S14e) [Streptococcus pyogenes NZ131]
          Length = 127

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 90/125 (72%), Gaps = 1/125 (0%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P+R R R +KNI  G AH+ +TFNNT + ITD HGN +AWSS   +GF GSRK++PFAAQ
Sbjct: 4   PTRKR-RVKKNIEFGVAHIHATFNNTIVMITDVHGNALAWSSAGALGFKGSRKSTPFAAQ 62

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           +A +  +  AQ HG+ ++EV V G G+GR+SA+RAL A G  + +I DVT + HNG RP 
Sbjct: 63  MAAEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLEVTAIRDVTPVPHNGARPP 122

Query: 125 KRRRI 129
           KRRR+
Sbjct: 123 KRRRV 127


>gi|300088171|ref|YP_003758693.1| 30S ribosomal protein S11 [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
 gi|299527904|gb|ADJ26372.1| 30S ribosomal protein S11 [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
          Length = 130

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 84/122 (68%)

Query: 8   IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
           ++ +E+KNI  G+A + +TFNNT IT+TD  GN +A +S    GF GSRK++P+AAQ+A 
Sbjct: 9   VKKKEKKNIPVGKAFIQATFNNTIITLTDLQGNALATTSAGNAGFKGSRKSTPYAAQMAA 68

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
            +C  KA   G+  +EV V G G+GR++A+R L+A G  +  I DVT I HNGCR  KRR
Sbjct: 69  QNCVKKAMESGLRQVEVFVKGPGSGREAAIRQLQASGLVVTGIRDVTPIPHNGCRAPKRR 128

Query: 128 RI 129
           R+
Sbjct: 129 RV 130


>gi|171462903|ref|YP_001797016.1| ribosomal protein S11 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|226708397|sp|B1XSS5|RS11_POLNS RecName: Full=30S ribosomal protein S11
 gi|171192441|gb|ACB43402.1| ribosomal protein S11 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 135

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 81/117 (69%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KN+  G AHV ++FNNT ITITD  GN ++W++    GF GSRK++PFAAQVA +    
Sbjct: 19  KKNVADGIAHVHTSFNNTIITITDRQGNALSWATSGGQGFKGSRKSTPFAAQVAAEVAGK 78

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            A   G+ SLE ++ G G GR+SA+RAL ++G  I  I DVT + HNGCRP KRRRI
Sbjct: 79  TAIECGIKSLEAQIKGPGPGRESAVRALNSLGIKITEIQDVTPVPHNGCRPPKRRRI 135


>gi|77918340|ref|YP_356155.1| 30S ribosomal protein S11 [Pelobacter carbinolicus DSM 2380]
 gi|91207664|sp|Q3A6M2|RS11_PELCD RecName: Full=30S ribosomal protein S11
 gi|77544423|gb|ABA87985.1| SSU ribosomal protein S11P [Pelobacter carbinolicus DSM 2380]
          Length = 131

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 68/118 (57%), Positives = 88/118 (74%)

Query: 12  ERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCS 71
           E+KNI +G AH+ +TFNNT +TITD  GN I+WS+   + F GSRK++PFAAQ+A +D +
Sbjct: 14  EKKNIANGIAHIQATFNNTIVTITDIAGNVISWSTCGTMNFKGSRKSTPFAAQIAAEDAA 73

Query: 72  AKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            KA  HG+ S+EV+V G G+GR+SALRAL + G  I  I DVT I HNGCRP KRRR+
Sbjct: 74  KKAMEHGLRSVEVRVKGPGSGRESALRALSSAGLNISVIKDVTPIPHNGCRPPKRRRV 131


>gi|257067035|ref|YP_003153291.1| 30S ribosomal protein S11 [Anaerococcus prevotii DSM 20548]
 gi|256798915|gb|ACV29570.1| ribosomal protein S11 [Anaerococcus prevotii DSM 20548]
          Length = 131

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 66/127 (51%), Positives = 91/127 (71%), Gaps = 1/127 (0%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K+ SR R R +KN+  G+AH+ STFNNT +T+TD  GN ++W+S   +GF GSRK++PFA
Sbjct: 6   KTTSR-RRRVKKNVERGQAHINSTFNNTMVTLTDMQGNALSWASAGQLGFRGSRKSTPFA 64

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           A  A D  + KA + G+ ++EV V G G+GR+SA+R+L+A G  +  I DVT I HNGCR
Sbjct: 65  ASEAADVAAKKAIDQGLKTVEVYVKGPGSGRESAIRSLQAAGLEVTMIKDVTPIPHNGCR 124

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 125 PPKRRRV 131


>gi|303233106|ref|ZP_07319779.1| 30S ribosomal protein S11 [Atopobium vaginae PB189-T1-4]
 gi|302480691|gb|EFL43778.1| 30S ribosomal protein S11 [Atopobium vaginae PB189-T1-4]
          Length = 132

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 90/132 (68%), Gaps = 3/132 (2%)

Query: 1   MPKSPSR---IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRK 57
           MPK   R   IR  ERKNI  G+AH+ +TFNNT I+ITDP GN IAW +    GF GSRK
Sbjct: 1   MPKKNQRTQHIRRSERKNIAVGQAHIKTTFNNTTISITDPQGNVIAWQTGGTAGFKGSRK 60

Query: 58  NSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIA 117
           ++PFAAQ+A + C+  A  HG+  + V V G G+GR++A+R+L+A G  +  I D T + 
Sbjct: 61  STPFAAQIAAEACAKAAMEHGLRKVAVFVKGPGSGRETAVRSLQAAGLEVSGIQDKTPVP 120

Query: 118 HNGCRPRKRRRI 129
           HNGCRP KRRR+
Sbjct: 121 HNGCRPCKRRRV 132


>gi|134298119|ref|YP_001111615.1| 30S ribosomal protein S11 [Desulfotomaculum reducens MI-1]
 gi|172044237|sp|A4J137|RS11_DESRM RecName: Full=30S ribosomal protein S11
 gi|134050819|gb|ABO48790.1| SSU ribosomal protein S11P [Desulfotomaculum reducens MI-1]
          Length = 129

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 90/129 (69%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M +   R + +++KN+  G AH+ STFNNT +TITD  GNT+ WSS   VGF GSRK++P
Sbjct: 1   MARRQVRTKRKDKKNVEQGVAHIKSTFNNTIVTITDLKGNTLGWSSAGQVGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  +  A  HG+  +EV V G G+GR++A+R+L+A G  +  I DVT I HNG
Sbjct: 61  FAAQMAAEAAAKDAMEHGLKEVEVTVKGPGSGREAAIRSLQAAGLEVNMIKDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|300114713|ref|YP_003761288.1| 30S ribosomal protein S11 [Nitrosococcus watsonii C-113]
 gi|299540650|gb|ADJ28967.1| 30S ribosomal protein S11 [Nitrosococcus watsonii C-113]
          Length = 127

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 83/121 (68%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R ++ +  G AH+ ++FNNT +TITD  GNT+AW++    GF GSRK++PFAAQVA +
Sbjct: 7   KKRVKRVVADGIAHIHASFNNTIVTITDRQGNTLAWATSGGSGFRGSRKSTPFAAQVAAE 66

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
                 Q  GM +LEV+V G G GR+SA R+L   GF + +I D+T I HNGCRP K+RR
Sbjct: 67  KAGRIVQEMGMKNLEVRVKGPGPGRESAARSLNNAGFKVTNIADITPIPHNGCRPPKKRR 126

Query: 129 I 129
           +
Sbjct: 127 V 127


>gi|283768438|ref|ZP_06341350.1| 30S ribosomal protein S11 [Bulleidia extructa W1219]
 gi|283104830|gb|EFC06202.1| 30S ribosomal protein S11 [Bulleidia extructa W1219]
          Length = 134

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 80/120 (66%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + + R+N+  G AH+ STFNNT +TI+D  GN +AWSS   +G+ GSRK++P+ AQ+  +
Sbjct: 14  KKKTRRNVAKGIAHIHSTFNNTIVTISDEAGNVVAWSSAGALGYKGSRKSTPYVAQLTAE 73

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
                A   GM S+EV V G GAGR++A+R+L+  G  I  I DVT I HNGCRP KR R
Sbjct: 74  AAGKAAVQQGMKSVEVNVKGPGAGREAAVRSLQTAGLNITVINDVTPIPHNGCRPPKRPR 133


>gi|325108638|ref|YP_004269706.1| 30S ribosomal protein S11P [Planctomyces brasiliensis DSM 5305]
 gi|324968906|gb|ADY59684.1| SSU ribosomal protein S11P [Planctomyces brasiliensis DSM 5305]
          Length = 126

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 85/121 (70%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R R+N+    AH+ +TFNNT +TITD +G  + W++   VGF GSRK++PFAAQ A +
Sbjct: 6   KKRVRRNVTKAIAHIKATFNNTLVTITDTNGEVLTWAAAGTVGFKGSRKSTPFAAQRAAE 65

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
            C+ +A+  G+  ++V+V G G+GR+SA+  L+A G TI  I DVT + HNGCRP K+RR
Sbjct: 66  VCADRAKKFGVREMDVRVKGPGSGRESAITGLQAPGITIKMIEDVTPLPHNGCRPPKKRR 125

Query: 129 I 129
           +
Sbjct: 126 V 126


>gi|302344331|ref|YP_003808860.1| 30S ribosomal protein S11 [Desulfarculus baarsii DSM 2075]
 gi|301640944|gb|ADK86266.1| 30S ribosomal protein S11 [Desulfarculus baarsii DSM 2075]
          Length = 131

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 87/121 (71%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + +ERKN+ +G  H+ STFNNT +TI D  G TI+WSS  V GF GSRK++PFAAQ+A +
Sbjct: 11  KRKERKNVPTGVVHIQSTFNNTIVTICDQQGATISWSSSGVQGFKGSRKSTPFAAQLAAE 70

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           D + KA  HGM ++EV V G GAGR++ALRA+   G  +  I DVT + HNGCRP KRRR
Sbjct: 71  DAAKKAMEHGMRTVEVNVKGPGAGREAALRAINNAGLNVSIIRDVTPVPHNGCRPPKRRR 130

Query: 129 I 129
           +
Sbjct: 131 V 131


>gi|21230386|ref|NP_636303.1| 30S ribosomal protein S11 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|21241759|ref|NP_641341.1| 30S ribosomal protein S11 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|66769620|ref|YP_244382.1| 30S ribosomal protein S11 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|78046577|ref|YP_362752.1| 30S ribosomal protein S11 [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|188992832|ref|YP_001904842.1| 30S ribosomal protein S11 [Xanthomonas campestris pv. campestris
           str. B100]
 gi|289665159|ref|ZP_06486740.1| 30S ribosomal protein S11 [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289669366|ref|ZP_06490441.1| 30S ribosomal protein S11 [Xanthomonas campestris pv. musacearum
           NCPPB4381]
 gi|294627860|ref|ZP_06706439.1| 30S ribosomal protein S11 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|294664165|ref|ZP_06729551.1| 30S ribosomal protein S11 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|325916509|ref|ZP_08178778.1| SSU ribosomal protein S11P [Xanthomonas vesicatoria ATCC 35937]
 gi|325925365|ref|ZP_08186767.1| SSU ribosomal protein S11P [Xanthomonas perforans 91-118]
 gi|59800195|sp|P0A0X2|RS11_XANCP RecName: Full=30S ribosomal protein S11
 gi|59800196|sp|P0A0X3|RS11_XANAC RecName: Full=30S ribosomal protein S11
 gi|81304425|sp|Q4URG1|RS11_XANC8 RecName: Full=30S ribosomal protein S11
 gi|91207687|sp|Q3BWW1|RS11_XANC5 RecName: Full=30S ribosomal protein S11
 gi|226708434|sp|B0RU60|RS11_XANCB RecName: Full=30S ribosomal protein S11
 gi|21107131|gb|AAM35877.1| 30S ribosomal protein S11 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21111943|gb|AAM40227.1| 30S ribosomal protein S11 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66574952|gb|AAY50362.1| 30S ribosomal protein S11 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|78035007|emb|CAJ22652.1| 30S ribosomal protein S11 [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|167734592|emb|CAP52802.1| 30S ribosomal protein S11 [Xanthomonas campestris pv. campestris]
 gi|292597774|gb|EFF41932.1| 30S ribosomal protein S11 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292606068|gb|EFF49333.1| 30S ribosomal protein S11 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|325537298|gb|EGD09025.1| SSU ribosomal protein S11P [Xanthomonas vesicatoria ATCC 35937]
 gi|325544243|gb|EGD15624.1| SSU ribosomal protein S11P [Xanthomonas perforans 91-118]
          Length = 130

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 82/114 (71%)

Query: 16  IVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQ 75
           I  G AHV ++FNNT +TITD  GN ++W++    GF GSRK++PFAAQVA +     A 
Sbjct: 17  ITDGVAHVHASFNNTIVTITDRQGNALSWATSGGAGFRGSRKSTPFAAQVAAEKAGRAAL 76

Query: 76  NHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           ++G+ SLEV++ G G GR+SA+R+L  +G+ I +I DVT I HNGCRP K+RR+
Sbjct: 77  DYGVKSLEVRIKGPGPGRESAVRSLNNVGYKITNIIDVTPIPHNGCRPPKKRRV 130


>gi|307823464|ref|ZP_07653693.1| 30S ribosomal protein S11 [Methylobacter tundripaludum SV96]
 gi|307735449|gb|EFO06297.1| 30S ribosomal protein S11 [Methylobacter tundripaludum SV96]
          Length = 128

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 86/126 (68%)

Query: 4   SPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAA 63
           S +R R R +K +  G  HV ++FNNT ITITD  GN ++W++    GF GSRK++PFAA
Sbjct: 3   SQNRSRKRIKKEVADGIVHVHASFNNTIITITDRKGNALSWATSGGSGFRGSRKSTPFAA 62

Query: 64  QVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRP 123
           QVA +   + A   GM +L+V + G G GR+SA+R+L  +GF I +I DVT I HNGCRP
Sbjct: 63  QVAAEKAGSVALEFGMKNLDVMIKGPGPGRESAVRSLNNLGFKINNIVDVTPIPHNGCRP 122

Query: 124 RKRRRI 129
            K+RR+
Sbjct: 123 PKKRRV 128


>gi|227501159|ref|ZP_03931208.1| ribosomal protein S11 [Anaerococcus tetradius ATCC 35098]
 gi|227216744|gb|EEI82145.1| ribosomal protein S11 [Anaerococcus tetradius ATCC 35098]
          Length = 131

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/127 (51%), Positives = 91/127 (71%), Gaps = 1/127 (0%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K+ SR R R +KN+  G+AH+ STFNNT +T+TD  GN ++W+S   +GF GSRK++PFA
Sbjct: 6   KTTSR-RRRVKKNVERGQAHINSTFNNTMVTLTDMQGNALSWASAGQLGFRGSRKSTPFA 64

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           A  A D  + KA + G+ ++EV V G G+GR+SA+R+L+A G  +  I DVT I HNGCR
Sbjct: 65  ASEAADVAAKKAIDQGLKTVEVYVKGPGSGRESAIRSLQAAGLEVTMIKDVTPIPHNGCR 124

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 125 PPKRRRV 131


>gi|320538143|ref|ZP_08038038.1| 30S ribosomal protein S11 [Treponema phagedenis F0421]
 gi|320144960|gb|EFW36681.1| 30S ribosomal protein S11 [Treponema phagedenis F0421]
          Length = 126

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 83/121 (68%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + +E+K++  G  ++ +TFNNT ITITD  GN ++W+S   +GF+G++K++PFAAQ   +
Sbjct: 6   KRKEKKSVYEGNVYIQATFNNTIITITDLKGNALSWASSGGLGFNGAKKSTPFAAQTVAE 65

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
               KAQ +G+  + V V G G GR+SA+R L  +G  + SI DVT I HNGCRPRK RR
Sbjct: 66  TAIQKAQQYGLREVHVFVKGPGVGRESAIRTLGVMGLKVRSISDVTPIPHNGCRPRKTRR 125

Query: 129 I 129
           +
Sbjct: 126 V 126


>gi|256847788|ref|ZP_05553233.1| 30S ribosomal protein S11 [Lactobacillus coleohominis 101-4-CHN]
 gi|256715477|gb|EEU30453.1| 30S ribosomal protein S11 [Lactobacillus coleohominis 101-4-CHN]
          Length = 128

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/115 (55%), Positives = 86/115 (74%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+ +G AH+ STFNNT I ITD  GN +AWSS  V+GF GSRK++PFAAQ+A++  + +A
Sbjct: 14  NVETGVAHIHSTFNNTLIMITDVQGNAVAWSSAGVLGFKGSRKSTPFAAQMASEAAAKQA 73

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HGM ++EV V G G+GR+SA+RAL+A G  + +I DVT + HNG RP KRRR+
Sbjct: 74  MEHGMKTVEVAVKGPGSGRESAIRALQATGLEVTAIRDVTPVPHNGSRPPKRRRV 128


>gi|315172669|gb|EFU16686.1| 30S ribosomal protein S11 [Enterococcus faecalis TX1346]
          Length = 129

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 88/121 (72%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI SG AH+ STFNNT + ITD HGN +AWSS   +GF GS+K+ PFAAQ+A +
Sbjct: 9   KRRVKKNIESGVAHIHSTFNNTIVMITDTHGNALAWSSAGSLGFKGSKKSPPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ +++V V G G+GR++A+R+L+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  AATKVAMEHGLKTVDVTVKGPGSGREAAIRSLQATGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|114567814|ref|YP_754968.1| 30S ribosomal protein S11 [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|122317308|sp|Q0AUK7|RS11_SYNWW RecName: Full=30S ribosomal protein S11
 gi|114338749|gb|ABI69597.1| SSU ribosomal protein S11P [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 130

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/118 (55%), Positives = 85/118 (72%)

Query: 12  ERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCS 71
           E+KNI  G AH+ STFNNT I+ITD HGN I+WSS   +GF GSRK++PFAAQ A ++ +
Sbjct: 13  EKKNIEHGIAHIKSTFNNTIISITDRHGNAISWSSAGTIGFKGSRKSTPFAAQQAAENAA 72

Query: 72  AKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             A  HG+  +E  V G GAGR++A+R+L+A G  +  I DVT I HNGCRP KRRR+
Sbjct: 73  KAAMEHGLKEVECYVKGPGAGREAAIRSLQAAGLEVSVIKDVTPIPHNGCRPPKRRRV 130


>gi|325479124|gb|EGC82221.1| 30S ribosomal protein S11 [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 131

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 87/121 (71%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R R +KN+  G+AH+ STFNNT +T+TD  GN ++W+S   +GF GSRK++PFAA  A D
Sbjct: 11  RRRVKKNVERGQAHINSTFNNTMVTLTDMQGNALSWASAGQLGFRGSRKSTPFAASEAAD 70

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + KA + G+ ++EV V G G+GR+SA+R+L+A G  +  I DVT I HNGCRP KRRR
Sbjct: 71  VAAKKAIDQGLKTVEVYVKGPGSGRESAIRSLQAAGLEVTMIKDVTPIPHNGCRPPKRRR 130

Query: 129 I 129
           +
Sbjct: 131 V 131


>gi|34849416|gb|AAP58915.1| ribosomal protein S11 [Spiroplasma kunkelii CR2-3x]
          Length = 129

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/110 (53%), Positives = 80/110 (72%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G AHV STFNNT +T++D  GN I+W+S   +GF GS+K++P+AAQ+  +     +Q HG
Sbjct: 19  GIAHVHSTFNNTIVTLSDEAGNVISWASAGAMGFKGSKKSTPYAAQMVAEAAGKASQEHG 78

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           MSS++V+V G G GRD+A+R+++AIG  I SI DVT I HNG RP KR R
Sbjct: 79  MSSVQVEVKGPGPGRDAAVRSIQAIGLEITSIKDVTPIPHNGARPPKRPR 128


>gi|325267153|ref|ZP_08133821.1| 30S ribosomal protein S11 [Kingella denitrificans ATCC 33394]
 gi|324981391|gb|EGC17035.1| 30S ribosomal protein S11 [Kingella denitrificans ATCC 33394]
          Length = 131

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 88/124 (70%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           SR+R + RK +  G  HV ++FNNT ITITD  GN ++W++    GF GSRK++PFAAQV
Sbjct: 8   SRVRKKVRKTVSEGIVHVHASFNNTIITITDRQGNALSWATSGGAGFKGSRKSTPFAAQV 67

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +     AQ +G+ +LE ++ G G GR+S++RAL A+GF I SI DVT + HNGCRP K
Sbjct: 68  AAEAAGKVAQEYGVKNLEARIKGPGPGRESSIRALNALGFKITSITDVTPLPHNGCRPPK 127

Query: 126 RRRI 129
           +RRI
Sbjct: 128 KRRI 131


>gi|84625022|ref|YP_452394.1| 30S ribosomal protein S11 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|166710855|ref|ZP_02242062.1| 30S ribosomal protein S11 [Xanthomonas oryzae pv. oryzicola BLS256]
 gi|188575512|ref|YP_001912441.1| 30S ribosomal protein S11 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|123725499|sp|Q2P007|RS11_XANOM RecName: Full=30S ribosomal protein S11
 gi|226708435|sp|B2SQT2|RS11_XANOP RecName: Full=30S ribosomal protein S11
 gi|84368962|dbj|BAE70120.1| 30S ribosomal protein S11 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188519964|gb|ACD57909.1| ribosomal protein S11 [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 130

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 82/114 (71%)

Query: 16  IVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQ 75
           I  G AHV ++FNNT +TITD  GN ++W++    GF GSRK++PFAAQVA +     A 
Sbjct: 17  ITDGVAHVHASFNNTIVTITDRQGNALSWATSGGAGFRGSRKSTPFAAQVAAEKAGRAAL 76

Query: 76  NHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           ++G+ SLEV++ G G GR+SA+R+L  +G+ I +I DVT I HNGCRP K+RR+
Sbjct: 77  DYGVKSLEVRIKGPGPGRESAVRSLNNVGYKITNIIDVTPIPHNGCRPPKKRRV 130


>gi|256831852|ref|YP_003160579.1| 30S ribosomal protein S11 [Jonesia denitrificans DSM 20603]
 gi|256685383|gb|ACV08276.1| ribosomal protein S11 [Jonesia denitrificans DSM 20603]
          Length = 135

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 93/127 (73%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           +S  + R +++KNI  G+AH+ STFNNT ++ITDP G  I+W+S   VGF GSRK++P+A
Sbjct: 9   QSARKPRRKDKKNISVGQAHIKSTFNNTIVSITDPSGAVISWASSGQVGFKGSRKSTPYA 68

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  + +AQ HGM  ++V V G G+GR++A+R+L+A G  + SI DVT  AHNGCR
Sbjct: 69  AQLAAESAARRAQEHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVGSIQDVTPQAHNGCR 128

Query: 123 PRKRRRI 129
             KRRR+
Sbjct: 129 QPKRRRV 135


>gi|254442359|ref|ZP_05055835.1| ribosomal protein S11, putative [Verrucomicrobiae bacterium DG1235]
 gi|198256667|gb|EDY80975.1| ribosomal protein S11, putative [Verrucomicrobiae bacterium DG1235]
          Length = 175

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 80/116 (68%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           KN+ +G A V +TFNNT +TITD  GNT++W+S   + F GSRK++ +AAQ+ T + +  
Sbjct: 60  KNVTAGIAKVSATFNNTIVTITDLKGNTVSWASAGKMNFRGSRKSTAYAAQIVTQNAAKA 119

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           A  HG+  + ++V G G GRDSA+RA + +G  I SI D T I HNGCRP KRRR+
Sbjct: 120 AMAHGLKEVSIEVKGPGMGRDSAIRAFQTLGLEISSITDTTPIPHNGCRPPKRRRV 175


>gi|153871949|ref|ZP_02000982.1| Ribosomal protein S11 [Beggiatoa sp. PS]
 gi|152071585|gb|EDN69018.1| Ribosomal protein S11 [Beggiatoa sp. PS]
          Length = 129

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 84/129 (65%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M     R   + +K++  G  HV ++FNNT ITITD  GN + W++    GF GSRK++P
Sbjct: 1   MANKEKRQPKKVKKHVTDGIVHVHASFNNTIITITDRQGNVLGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +      +  G+ +LEV++ G G GR+SA+R+L A GF I SI DVT I HNG
Sbjct: 61  FAAQIAAEKVGNAVKEFGVKNLEVQIKGPGPGRESAVRSLNANGFKITSITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 121 CRPPKRRRV 129


>gi|320526893|ref|ZP_08028083.1| 30S ribosomal protein S11 [Solobacterium moorei F0204]
 gi|320132861|gb|EFW25401.1| 30S ribosomal protein S11 [Solobacterium moorei F0204]
          Length = 134

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 80/120 (66%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + + R+N+  G AH+ STFNNT +TI+D  GN I+WSS   +G+ GSRK++P+ AQ+  +
Sbjct: 14  KKKARRNVAKGIAHIHSTFNNTIVTISDEAGNVISWSSAGALGYKGSRKSTPYVAQLCAE 73

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
                A   GM S+EV V G GAGR+SA+R+L+  G  I  I DVT I HNGCRP KR R
Sbjct: 74  AAGKAAVQQGMKSVEVNVKGPGAGRESAVRSLQTAGLEITVINDVTPIPHNGCRPPKRPR 133


>gi|116495922|ref|YP_807656.1| 30S ribosomal protein S11 [Lactobacillus casei ATCC 334]
 gi|191639404|ref|YP_001988570.1| 30S ribosomal protein S11 [Lactobacillus casei BL23]
 gi|199598857|ref|ZP_03212268.1| 30S ribosomal protein S11 [Lactobacillus rhamnosus HN001]
 gi|227533984|ref|ZP_03964033.1| ribosomal protein S11 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|229552732|ref|ZP_04441457.1| ribosomal protein S11 [Lactobacillus rhamnosus LMS2-1]
 gi|239630327|ref|ZP_04673358.1| 30S ribosomal protein S11 [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|258509457|ref|YP_003172208.1| 30S ribosomal protein S11 [Lactobacillus rhamnosus GG]
 gi|258540655|ref|YP_003175154.1| 30S ribosomal protein S11 [Lactobacillus rhamnosus Lc 705]
 gi|301067479|ref|YP_003789502.1| 30S ribosomal protein L11 [Lactobacillus casei str. Zhang]
 gi|122262678|sp|Q035A8|RS11_LACC3 RecName: Full=30S ribosomal protein S11
 gi|226708379|sp|B3WAJ3|RS11_LACCB RecName: Full=30S ribosomal protein S11
 gi|116106072|gb|ABJ71214.1| SSU ribosomal protein S11P [Lactobacillus casei ATCC 334]
 gi|190713706|emb|CAQ67712.1| 30S ribosomal protein S11 [Lactobacillus casei BL23]
 gi|199590269|gb|EDY98364.1| 30S ribosomal protein S11 [Lactobacillus rhamnosus HN001]
 gi|227188361|gb|EEI68428.1| ribosomal protein S11 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|229313938|gb|EEN79911.1| ribosomal protein S11 [Lactobacillus rhamnosus LMS2-1]
 gi|239527939|gb|EEQ66940.1| 30S ribosomal protein S11 [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|257149384|emb|CAR88357.1| SSU/30S ribosomal protein S11P [Lactobacillus rhamnosus GG]
 gi|257152331|emb|CAR91303.1| SSU/30S ribosomal protein S11P [Lactobacillus rhamnosus Lc 705]
 gi|259650736|dbj|BAI42898.1| 30S ribosomal protein S11 [Lactobacillus rhamnosus GG]
 gi|300439886|gb|ADK19652.1| Ribosomal protein S11 [Lactobacillus casei str. Zhang]
 gi|327383492|gb|AEA54968.1| 30S ribosomal protein S11 [Lactobacillus casei LC2W]
 gi|327386685|gb|AEA58159.1| 30S ribosomal protein S11 [Lactobacillus casei BD-II]
          Length = 129

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/115 (54%), Positives = 85/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+ SG AH+ STFNNT + ITDP GN IAWSS   +GF GSRK++PFAAQ+A +  + ++
Sbjct: 15  NVESGVAHIHSTFNNTLVMITDPRGNAIAWSSAGALGFKGSRKSTPFAAQMAAEAAAKES 74

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HGM S+EV V G G+GR++A+R+L+A G  + +I DVT + HNG RP KRRR+
Sbjct: 75  MEHGMKSVEVAVKGPGSGREAAIRSLQATGLEVTAIRDVTPVPHNGSRPPKRRRV 129


>gi|238928130|ref|ZP_04659890.1| ribosomal protein S11 [Selenomonas flueggei ATCC 43531]
 gi|292669833|ref|ZP_06603259.1| 30S ribosomal protein S11 [Selenomonas noxia ATCC 43541]
 gi|304438387|ref|ZP_07398328.1| 30S ribosomal protein S11 [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|238884090|gb|EEQ47728.1| ribosomal protein S11 [Selenomonas flueggei ATCC 43531]
 gi|292648630|gb|EFF66602.1| 30S ribosomal protein S11 [Selenomonas noxia ATCC 43541]
 gi|304368753|gb|EFM22437.1| 30S ribosomal protein S11 [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 130

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 67/127 (52%), Positives = 91/127 (71%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K  +R + + RKNI SG AH+ STFNNT +T+TD  GN ++W+S   +GF GSRK++PFA
Sbjct: 4   KKTTRSKKKVRKNIESGVAHISSTFNNTIVTLTDKSGNALSWASAGGLGFRGSRKSTPFA 63

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  +  A  HG+ S+EV V G GAGR++A+R+L+A G  +  I DVT I HNGCR
Sbjct: 64  AQMAAETAAKAAMEHGLKSVEVYVKGPGAGREAAIRSLQATGLEVNMIKDVTPIPHNGCR 123

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 124 PPKRRRV 130


>gi|225376436|ref|ZP_03753657.1| hypothetical protein ROSEINA2194_02078 [Roseburia inulinivorans DSM
           16841]
 gi|225211812|gb|EEG94166.1| hypothetical protein ROSEINA2194_02078 [Roseburia inulinivorans DSM
           16841]
          Length = 130

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 84/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GS+K++P+AAQ+A +  +  A
Sbjct: 16  NVERGQAHIQSSFNNTIVTLTDAEGNALSWASAGGLGFRGSKKSTPYAAQMAAETATKAA 75

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ S++V V G G+GR++A+RAL A G  + SI DVT + HNGCRP KRRR+
Sbjct: 76  LIHGLKSVDVFVKGPGSGREAAIRALSACGLEVTSIKDVTPVPHNGCRPPKRRRV 130


>gi|291460743|ref|ZP_06600133.1| 30S ribosomal protein S11 [Oribacterium sp. oral taxon 078 str.
           F0262]
 gi|291416702|gb|EFE90421.1| 30S ribosomal protein S11 [Oribacterium sp. oral taxon 078 str.
           F0262]
          Length = 131

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 83/115 (72%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GSRK++P+AAQ+A +     A
Sbjct: 17  NVERGQAHIQSSFNNTIVTLTDAQGNALSWASAGGLGFRGSRKSTPYAAQMAAETAVKAA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+  ++V V G G+GR++A+RAL+A G  + SI DVT + HNGCRP KRRR+
Sbjct: 77  LVHGLKYVDVMVKGPGSGREAAIRALQANGLEVTSIKDVTPVPHNGCRPPKRRRV 131


>gi|116334244|ref|YP_795771.1| 30S ribosomal protein S11 [Lactobacillus brevis ATCC 367]
 gi|122269074|sp|Q03PY2|RS11_LACBA RecName: Full=30S ribosomal protein S11
 gi|116099591|gb|ABJ64740.1| SSU ribosomal protein S11P [Lactobacillus brevis ATCC 367]
          Length = 129

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 88/121 (72%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI +G AH+ +TFNNT + ITD  GN IAWSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVKKNIEAGVAHIHATFNNTLVMITDVQGNAIAWSSAGALGFKGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  +Q HG+ S+EV V G G+GR+SA+RA++A G  I +I DVT + HNG RP KRRR
Sbjct: 69  AAAKASQEHGIKSVEVAVKGPGSGRESAIRAIQAAGIEITAIRDVTPVPHNGTRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|296137041|ref|YP_003644283.1| 30S ribosomal protein S11 [Thiomonas intermedia K12]
 gi|294341218|emb|CAZ89619.1| 30S ribosomal subunit protein S11 [Thiomonas sp. 3As]
 gi|295797163|gb|ADG31953.1| 30S ribosomal protein S11 [Thiomonas intermedia K12]
          Length = 135

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 83/123 (67%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R R + RKN+  G AHV ++FNNT ITITD  GN ++ SS    GF GSRK++PFAAQVA
Sbjct: 13  RARKKVRKNVSDGIAHVHASFNNTIITITDRQGNALSASSSGAQGFKGSRKSTPFAAQVA 72

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +     A  +G+ +LEV + G G GR+S++RAL  +G  +  I DVT I HNGCRP KR
Sbjct: 73  AEQAGRVALEYGIKNLEVFIKGPGPGRESSVRALNNLGIKVTLIEDVTPIPHNGCRPPKR 132

Query: 127 RRI 129
           RR+
Sbjct: 133 RRV 135


>gi|254468658|ref|ZP_05082064.1| ribosomal protein S11 [beta proteobacterium KB13]
 gi|207087468|gb|EDZ64751.1| ribosomal protein S11 [beta proteobacterium KB13]
          Length = 129

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 93/129 (72%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M KS +R++ + +KN+  G AHV ++FNNT ITITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKSNTRVKKKIKKNVAEGIAHVHASFNNTIITITDRQGNALSWATSGGAGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     AQ +G+ ++EV++ G G GR+S++RAL +IG  I +I DVT + HNG
Sbjct: 61  FAAQVAAEAAGKAAQEYGVKNVEVRIKGPGPGRESSVRALNSIGLKITAIQDVTPVPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RRI
Sbjct: 121 CRPPKKRRI 129


>gi|212697278|ref|ZP_03305406.1| hypothetical protein ANHYDRO_01846 [Anaerococcus hydrogenalis DSM
           7454]
 gi|325848962|ref|ZP_08170472.1| 30S ribosomal protein S11 [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
 gi|212675727|gb|EEB35334.1| hypothetical protein ANHYDRO_01846 [Anaerococcus hydrogenalis DSM
           7454]
 gi|325480606|gb|EGC83668.1| 30S ribosomal protein S11 [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
          Length = 134

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 91/126 (72%)

Query: 4   SPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAA 63
           S  R R R +KN+  G+AH+ STFNNT +T+TD  GN ++W+S   +GF GSRK++PFAA
Sbjct: 9   SAKRGRRRVKKNVERGQAHINSTFNNTMVTLTDAQGNALSWASAGQLGFRGSRKSTPFAA 68

Query: 64  QVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRP 123
           Q A  + + KA ++G+ S+EV V G G+GR+SA+R+L+A G  +  I DVT I HNGCRP
Sbjct: 69  QEAALEAAKKAMDYGLKSVEVFVKGPGSGRESAIRSLQAAGLEVTMIKDVTPIPHNGCRP 128

Query: 124 RKRRRI 129
            KRRR+
Sbjct: 129 PKRRRV 134


>gi|256544531|ref|ZP_05471904.1| 30S ribosomal protein S11 [Anaerococcus vaginalis ATCC 51170]
 gi|256399856|gb|EEU13460.1| 30S ribosomal protein S11 [Anaerococcus vaginalis ATCC 51170]
          Length = 134

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 90/126 (71%)

Query: 4   SPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAA 63
           S  R R R +KN+  G+AH+ STFNNT +T+TD  GN ++W+S   +GF GSRK++PFAA
Sbjct: 9   SAKRGRRRVKKNVERGQAHINSTFNNTMVTLTDAQGNALSWASAGQLGFRGSRKSTPFAA 68

Query: 64  QVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRP 123
           Q A  + + KA  +G+ S+EV V G G+GR+SA+R+L+A G  +  I DVT I HNGCRP
Sbjct: 69  QEAALEAAKKAMEYGLKSVEVFVKGPGSGRESAIRSLQAAGLEVTMIKDVTPIPHNGCRP 128

Query: 124 RKRRRI 129
            KRRR+
Sbjct: 129 PKRRRV 134


>gi|319787903|ref|YP_004147378.1| 30S ribosomal protein S11 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466415|gb|ADV28147.1| 30S ribosomal protein S11 [Pseudoxanthomonas suwonensis 11-1]
          Length = 130

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 82/114 (71%)

Query: 16  IVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQ 75
           +  G AHV ++FNNT +TITD  GN ++W++    GF GSRK++PFAAQVA +     A 
Sbjct: 17  VTDGIAHVHASFNNTIVTITDRQGNALSWATSGGAGFRGSRKSTPFAAQVAAEKAGKAAL 76

Query: 76  NHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           ++G+ SLEV++ G G GR+SA+R+L  +G+ I +I DVT I HNGCRP K+RR+
Sbjct: 77  DYGVKSLEVRIKGPGPGRESAVRSLNNVGYKITNIIDVTPIPHNGCRPPKKRRV 130


>gi|227876168|ref|ZP_03994284.1| ribosomal protein S11 [Mobiluncus mulieris ATCC 35243]
 gi|269976925|ref|ZP_06183899.1| 30S ribosomal protein S11 [Mobiluncus mulieris 28-1]
 gi|306819443|ref|ZP_07453150.1| 30S ribosomal protein S11 [Mobiluncus mulieris ATCC 35239]
 gi|307701702|ref|ZP_07638718.1| 30S ribosomal protein S11 [Mobiluncus mulieris FB024-16]
 gi|227843129|gb|EEJ53322.1| ribosomal protein S11 [Mobiluncus mulieris ATCC 35243]
 gi|269934756|gb|EEZ91316.1| 30S ribosomal protein S11 [Mobiluncus mulieris 28-1]
 gi|304647735|gb|EFM45053.1| 30S ribosomal protein S11 [Mobiluncus mulieris ATCC 35239]
 gi|307613205|gb|EFN92458.1| 30S ribosomal protein S11 [Mobiluncus mulieris FB024-16]
          Length = 130

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 93/127 (73%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K+ S+ R +ERKN+  G A++ STFNNT ++ITDP G  IA +S   VGF GSRK++PFA
Sbjct: 4   KTASKPRRKERKNVAEGNAYIKSTFNNTIVSITDPTGAVIASASSGQVGFKGSRKSTPFA 63

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  + +AQ HGM  ++V V G G+GR++A+R+L+A G  + SI DVT  AHNGCR
Sbjct: 64  AQLAAEAAARRAQEHGMKKVDVYVKGPGSGRETAIRSLQAAGLEVGSIQDVTPQAHNGCR 123

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 124 PPKRRRV 130


>gi|301057480|ref|ZP_07198576.1| 30S ribosomal protein S11 [delta proteobacterium NaphS2]
 gi|300448408|gb|EFK12077.1| 30S ribosomal protein S11 [delta proteobacterium NaphS2]
          Length = 131

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/115 (56%), Positives = 78/115 (67%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+ +G  H+ STFNNT ITITD  GN IA SS    G  GSRK++PFAAQ+A  D   KA
Sbjct: 17  NVPTGIVHIQSTFNNTIITITDTSGNVIAQSSAGRGGVKGSRKSTPFAAQIAGRDALKKA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
              GM   EV+V G G GR++ALR+L+  GFT+  I DVT I HNGCRP KRRR+
Sbjct: 77  MEQGMRVAEVRVKGPGVGREAALRSLQVEGFTVTMIRDVTPIPHNGCRPPKRRRV 131


>gi|329945756|ref|ZP_08293443.1| 30S ribosomal protein S11 [Actinomyces sp. oral taxon 170 str.
           F0386]
 gi|328528204|gb|EGF55182.1| 30S ribosomal protein S11 [Actinomyces sp. oral taxon 170 str.
           F0386]
          Length = 133

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 89/123 (72%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           + R ++RKN+  G A++ STFNNT +++TDP G  IAW S   VGF GSRK++P+AAQ+A
Sbjct: 11  KTRRKDRKNVTHGHAYIKSTFNNTIVSLTDPQGAVIAWCSSGQVGFKGSRKSTPYAAQLA 70

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +AQ HGM  ++V V G G+GR++A+R+L+A G  + SI DVT  A NGCRP KR
Sbjct: 71  AESAARRAQEHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVGSITDVTPQAFNGCRPPKR 130

Query: 127 RRI 129
           RR+
Sbjct: 131 RRV 133


>gi|198282662|ref|YP_002218983.1| 30S ribosomal protein S11 [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218666308|ref|YP_002424855.1| ribosomal protein S11 [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198247183|gb|ACH82776.1| ribosomal protein S11 [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218518521|gb|ACK79107.1| ribosomal protein S11 [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 131

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 90/124 (72%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R R + +KN++ G AH+ ++FNNT ITI+D  GN + W+S    GF GSRK++PFAAQV
Sbjct: 8   TRARKKVKKNVLDGVAHIYASFNNTIITISDRQGNVLTWASSGGSGFRGSRKSTPFAAQV 67

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A ++   KAQ  G+ +L+V+V G G GR+S +RAL +IGF I SI DVT I HNGCRP K
Sbjct: 68  AAENAGKKAQEFGVKNLDVEVRGPGPGRESTVRALHSIGFRIASIRDVTPIPHNGCRPPK 127

Query: 126 RRRI 129
           +RR+
Sbjct: 128 KRRV 131


>gi|237786336|ref|YP_002907041.1| 30S ribosomal protein S11 [Corynebacterium kroppenstedtii DSM
           44385]
 gi|259494617|sp|C4LKZ3|RS11_CORK4 RecName: Full=30S ribosomal protein S11
 gi|237759248|gb|ACR18498.1| 30S ribosomal protein S11 [Corynebacterium kroppenstedtii DSM
           44385]
          Length = 134

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 88/117 (75%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KN+ +G A++ STFNNT ++ITDP+G  I+W+S   VGF GSRK++PFAAQ+A +  + 
Sbjct: 18  KKNVANGHAYIKSTFNNTIVSITDPNGAVISWASSGHVGFKGSRKSTPFAAQMAAESAAR 77

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           KAQ HG+  +EV V G G+GR++A+R+L+A G  + SI DVT   HNGCRP KRRR+
Sbjct: 78  KAQEHGLKKVEVFVKGPGSGRETAIRSLQAAGLEVNSISDVTPQPHNGCRPPKRRRV 134


>gi|307244782|ref|ZP_07526883.1| 30S ribosomal protein S11 [Peptostreptococcus stomatis DSM 17678]
 gi|306491880|gb|EFM63932.1| 30S ribosomal protein S11 [Peptostreptococcus stomatis DSM 17678]
          Length = 133

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 83/115 (72%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI  G AH+ STFNNT +T+TD HGN I+W+S   +GF GSRK +P+A+Q+A +  +  A
Sbjct: 19  NIERGHAHIQSTFNNTIVTLTDVHGNAISWASSGQLGFKGSRKATPYASQMAAETAAKAA 78

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ ++EV V G G+GR++A+RAL+A G  +  I DVT I HNGCRP KRRR+
Sbjct: 79  MEHGLKTVEVFVKGPGSGREAAIRALQATGLEVTMIKDVTPIPHNGCRPPKRRRV 133


>gi|225020482|ref|ZP_03709674.1| hypothetical protein CORMATOL_00489 [Corynebacterium matruchotii
           ATCC 33806]
 gi|305680058|ref|ZP_07402868.1| 30S ribosomal protein S11 [Corynebacterium matruchotii ATCC 14266]
 gi|224946871|gb|EEG28080.1| hypothetical protein CORMATOL_00489 [Corynebacterium matruchotii
           ATCC 33806]
 gi|305660678|gb|EFM50175.1| 30S ribosomal protein S11 [Corynebacterium matruchotii ATCC 14266]
          Length = 134

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 88/117 (75%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KN+ +G A++ STFNNT ++ITDPHG  I+W+S   VGF GSRK++PFAAQ+A ++ + 
Sbjct: 18  KKNVAAGHAYIKSTFNNTIVSITDPHGAVISWASSGHVGFKGSRKSTPFAAQLAAENAAR 77

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           KA +HGM S+EV V G G+GR++A+R+L+A G  +  I DVT    NGCRP KRRR+
Sbjct: 78  KAMDHGMKSVEVFVKGPGSGRETAIRSLQAAGLEVTKISDVTPQPFNGCRPPKRRRV 134


>gi|297625816|ref|YP_003687579.1| 30S ribosomal protein S11 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
 gi|296921581|emb|CBL56135.1| 30S ribosomal protein S11 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
          Length = 135

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/115 (54%), Positives = 86/115 (74%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+V+G AH+ STFNNT I I+DP+G  IAW+S   VGF GSRK++PFAAQ+A +    +A
Sbjct: 21  NVVTGEAHIKSTFNNTIIAISDPNGAVIAWASAGTVGFKGSRKSTPFAAQMAAEAAGRRA 80

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            +HGM  ++V V G G+GR++A+R+L AIG  + +I DVT + HNGCRP KRRR+
Sbjct: 81  MDHGMKRVDVFVKGPGSGRETAIRSLGAIGLEVGTISDVTPVPHNGCRPPKRRRV 135


>gi|152060818|sp|Q2S3P1|RS11_SALRD RecName: Full=30S ribosomal protein S11
          Length = 134

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 87/124 (70%), Gaps = 3/124 (2%)

Query: 9   RNRERKNIV---SGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           R  ++KN+V   +GRA+V +TFNN  +T+TD +GNTI+W+S   +GF GSRKN+P+AAQ 
Sbjct: 11  RTPQKKNVVVESNGRAYVKATFNNVIVTLTDQYGNTISWASAGKMGFKGSRKNTPYAAQK 70

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  + +A   G+  ++V V G G+GR+ A+RA+   G  + SI DVT + HNGCRP K
Sbjct: 71  AGESAANEAYELGLRRVDVYVKGPGSGREGAIRAMSESGLEVASIRDVTPLPHNGCRPPK 130

Query: 126 RRRI 129
           RRR+
Sbjct: 131 RRRV 134


>gi|126666790|ref|ZP_01737767.1| 30S ribosomal protein S11 [Marinobacter sp. ELB17]
 gi|126628835|gb|EAZ99455.1| 30S ribosomal protein S11 [Marinobacter sp. ELB17]
          Length = 129

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 90/129 (69%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R R + +K +V G AH+ ++FNNT +TI+D  GN ++W++    GF GSRK++P
Sbjct: 1   MAKPGTRTRKKVKKTVVDGVAHIHASFNNTIVTISDRQGNVLSWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     A  +G+ +L+V+V G G GR+SA+RAL + G+ I +I DVT I HNG
Sbjct: 61  FAAQVAAERAGNAAAEYGLKNLDVEVKGPGPGRESAVRALNSCGYKINNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|108804949|ref|YP_644886.1| 30S ribosomal protein S11 [Rubrobacter xylanophilus DSM 9941]
 gi|123177179|sp|Q1AU54|RS11_RUBXD RecName: Full=30S ribosomal protein S11
 gi|108766192|gb|ABG05074.1| SSU ribosomal protein S11P [Rubrobacter xylanophilus DSM 9941]
          Length = 135

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 80/116 (68%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           RKNI +   H+ S+FNNT I++TD  GN IAW S   +GF GSRK++P+AAQ+  +  + 
Sbjct: 19  RKNISTAVVHIKSSFNNTIISVTDQEGNVIAWESAGSMGFKGSRKSTPYAAQMTAESAAN 78

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           KA  HG+  ++++V G G+GRD A R  +A+G  ++SI DVT   HNGCRP KRRR
Sbjct: 79  KAMEHGVKRVDIQVKGHGSGRDMAARTFQAMGIEVLSIKDVTGQPHNGCRPPKRRR 134


>gi|162456221|ref|YP_001618588.1| hypothetical protein sce7938 [Sorangium cellulosum 'So ce 56']
 gi|161166803|emb|CAN98108.1| rpsK [Sorangium cellulosum 'So ce 56']
          Length = 136

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 86/115 (74%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+ +G AH+ STFNNT +TITD +GN IAWSS    GF GSRK++PFAAQ+A ++ + +A
Sbjct: 22  NVSAGIAHIQSTFNNTVVTITDINGNAIAWSSAGARGFKGSRKSTPFAAQLAAEEAARRA 81

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           Q HGM S+ V V G GAGR+SALRAL+  GF +  I DVT I HNGCRP KRRR+
Sbjct: 82  QEHGMRSVAVFVKGPGAGRESALRALQTAGFKVTLIRDVTPIPHNGCRPPKRRRV 136


>gi|323706477|ref|ZP_08118038.1| 30S ribosomal protein S11 [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323534197|gb|EGB23987.1| 30S ribosomal protein S11 [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 130

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 88/121 (72%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + RERKN+  G AH+ STFNNT +T+TD  GN +AWSS   +GF GSRK++P+AAQ+A +
Sbjct: 10  KRRERKNVERGAAHIHSTFNNTIVTLTDMAGNALAWSSAGTLGFKGSRKSTPYAAQMAAE 69

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ +++V V G GAGR++A+RAL+A G  +  I DVT I HNGCRP KRRR
Sbjct: 70  TAAKAAMEHGLKTVDVFVKGPGAGREAAIRALQAAGLEVSLIKDVTPIPHNGCRPPKRRR 129

Query: 129 I 129
           +
Sbjct: 130 V 130


>gi|206895879|ref|YP_002247309.1| ribosomal protein S11 [Coprothermobacter proteolyticus DSM 5265]
 gi|226708351|sp|B5Y962|RS11_COPPD RecName: Full=30S ribosomal protein S11
 gi|206738496|gb|ACI17574.1| ribosomal protein S11 [Coprothermobacter proteolyticus DSM 5265]
          Length = 125

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 86/122 (70%), Gaps = 2/122 (1%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + +ER+ +  G AH+ STFNNT ITITDP+G  +AW+S     F G+RK +P+AAQ+A++
Sbjct: 5   KRKERRYVPYGVAHIHSTFNNTIITITDPNGAVLAWASGGFF-FKGTRKGTPYAAQLASE 63

Query: 69  DCSAKAQN-HGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
             + K Q  +GM  ++V V G G GR++A+RAL+A+G  + SI DVT I HNGCRP K R
Sbjct: 64  SVAKKVQQTYGMKEIDVFVKGPGPGRETAIRALQAVGLDVKSIKDVTPIPHNGCRPPKAR 123

Query: 128 RI 129
           R+
Sbjct: 124 RV 125


>gi|291542057|emb|CBL15167.1| SSU ribosomal protein S11P [Ruminococcus bromii L2-63]
          Length = 133

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/130 (50%), Positives = 88/130 (67%), Gaps = 2/130 (1%)

Query: 2   PKSPSRI--RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           PK   ++  R RERK+I  G AH+ STFNNT +TI+D  GN ++W+S   +GF GS+K++
Sbjct: 4   PKGGKKVIRRRRERKHIEKGAAHIQSTFNNTIVTISDTQGNAVSWASAGELGFRGSKKST 63

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           PFAAQ A +  +  A  HGM  +EV V G G GR++A+RAL+  G  +  I DVT I HN
Sbjct: 64  PFAAQSAAETAAKAAMEHGMKYVEVYVKGPGQGREAAIRALQTAGLEVTMIKDVTPIPHN 123

Query: 120 GCRPRKRRRI 129
           GCRP KRRR+
Sbjct: 124 GCRPPKRRRV 133


>gi|285017342|ref|YP_003375053.1| 30s ribosomal protein s11 [Xanthomonas albilineans GPE PC73]
 gi|283472560|emb|CBA15065.1| probable 30s ribosomal protein s11 [Xanthomonas albilineans]
          Length = 130

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 82/114 (71%)

Query: 16  IVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQ 75
           +  G AHV ++FNNT +TITD  GN ++W++    GF GSRK++PFAAQVA +     A 
Sbjct: 17  VTDGVAHVHASFNNTIVTITDRQGNALSWATSGGAGFRGSRKSTPFAAQVAAEKAGRAAL 76

Query: 76  NHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           ++G+ SLEV++ G G GR+SA+R+L  +G+ I +I DVT I HNGCRP K+RR+
Sbjct: 77  DYGVKSLEVRIKGPGPGRESAVRSLNNVGYKITNIIDVTPIPHNGCRPPKKRRV 130


>gi|190572966|ref|YP_001970811.1| 30S ribosomal protein S11 [Stenotrophomonas maltophilia K279a]
 gi|194364556|ref|YP_002027166.1| 30S ribosomal protein S11 [Stenotrophomonas maltophilia R551-3]
 gi|254523559|ref|ZP_05135614.1| ribosomal protein S11 [Stenotrophomonas sp. SKA14]
 gi|226708420|sp|B4SLH3|RS11_STRM5 RecName: Full=30S ribosomal protein S11
 gi|226708421|sp|B2FQK6|RS11_STRMK RecName: Full=30S ribosomal protein S11
 gi|190010888|emb|CAQ44497.1| putative 30S ribosomal protein S11 [Stenotrophomonas maltophilia
           K279a]
 gi|194347360|gb|ACF50483.1| ribosomal protein S11 [Stenotrophomonas maltophilia R551-3]
 gi|219721150|gb|EED39675.1| ribosomal protein S11 [Stenotrophomonas sp. SKA14]
          Length = 129

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 82/114 (71%)

Query: 16  IVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQ 75
           +  G AHV ++FNNT +TITD  GN ++W++    GF GSRK++PFAAQVA +     A 
Sbjct: 16  VTDGVAHVHASFNNTIVTITDRQGNALSWATSGGAGFRGSRKSTPFAAQVAAEKAGRAAL 75

Query: 76  NHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           ++G+ SLEV++ G G GR+SA+R+L  +G+ I +I DVT I HNGCRP K+RR+
Sbjct: 76  DYGVKSLEVRIKGPGPGRESAVRSLNNVGYKITNIIDVTPIPHNGCRPPKKRRV 129


>gi|329577724|gb|EGG59150.1| 30S ribosomal protein S11 [Enterococcus faecalis TX1467]
          Length = 129

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 88/121 (72%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI SG AH+ STFNNT + I D HGN +AWSS   +GF GS+K++PFAAQ+A +
Sbjct: 9   KRRVKKNIESGVAHIHSTFNNTIVMIADTHGNALAWSSAGSLGFKGSKKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ +++V V G G+GR++A+R+L+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  AATKVAMEHGLKTVDVTVKGPGSGREAAIRSLQATGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|107103756|ref|ZP_01367674.1| hypothetical protein PaerPA_01004827 [Pseudomonas aeruginosa PACS2]
          Length = 114

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 60/114 (52%), Positives = 81/114 (71%)

Query: 16  IVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQ 75
           +V G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++PFAAQVA +     A 
Sbjct: 1   MVDGIAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTPFAAQVAAERAGQAAL 60

Query: 76  NHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            +G+ +L+V V G G GR+SA+RAL A G+ I SI DVT I HNGCRP K+RR+
Sbjct: 61  EYGLKNLDVNVKGPGPGRESAVRALNACGYKIASITDVTPIPHNGCRPPKKRRV 114


>gi|315640137|ref|ZP_07895259.1| 30S ribosomal protein S11 [Enterococcus italicus DSM 15952]
 gi|315484114|gb|EFU74588.1| 30S ribosomal protein S11 [Enterococcus italicus DSM 15952]
          Length = 129

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 88/121 (72%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI SG AH+ STFNNT + ITD HGN +AWSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVKKNIESGIAHIHSTFNNTIVMITDTHGNALAWSSAGALGFKGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+  +EV V G G+GR++A+R+L+A G  + +I DVT + HNGCRP KRRR
Sbjct: 69  TAAKAAMEHGLRIVEVTVKGPGSGREAAIRSLQAAGLEVTAIRDVTPVPHNGCRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|282857337|ref|ZP_06266574.1| 30S ribosomal protein S11 [Pyramidobacter piscolens W5455]
 gi|282584837|gb|EFB90168.1| 30S ribosomal protein S11 [Pyramidobacter piscolens W5455]
          Length = 127

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 88/121 (72%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +E+KNI  G AH+ STFNNT ++ITD  G  +AW+S   VGF G+RK++PFAAQVA+ 
Sbjct: 7   RKKEKKNISYGVAHIFSTFNNTIVSITDKGGALLAWASGGNVGFKGARKSTPFAAQVASQ 66

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  AQ+HG+  ++V V G G GR+SA+RAL+A+G  + SI D T I HNGCRP KRRR
Sbjct: 67  QAAKTAQDHGLREIDVVVKGPGPGRESAIRALQAVGLQVNSIRDETPIPHNGCRPPKRRR 126

Query: 129 I 129
           +
Sbjct: 127 V 127


>gi|220930991|ref|YP_002507899.1| ribosomal protein S11 [Halothermothrix orenii H 168]
 gi|219992301|gb|ACL68904.1| ribosomal protein S11 [Halothermothrix orenii H 168]
          Length = 132

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/115 (56%), Positives = 85/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI  G+AH+ STFNNT +TITD  GN IAWSS   VG+ GSRK++PFAAQ+A +D + +A
Sbjct: 18  NIEKGQAHIKSTFNNTVVTITDKEGNVIAWSSGGKVGYKGSRKSTPFAAQLAAEDAAKQA 77

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            + G+  +E+ V G G+GR+SA+R+L+A G  +  I DVT I HNGCRP KRRRI
Sbjct: 78  MDQGLKEVEIYVKGPGSGRESAIRSLQATGLNVSIIKDVTPIPHNGCRPPKRRRI 132


>gi|313895382|ref|ZP_07828939.1| 30S ribosomal protein S11 [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|320529821|ref|ZP_08030898.1| 30S ribosomal protein S11 [Selenomonas artemidis F0399]
 gi|312976277|gb|EFR41735.1| 30S ribosomal protein S11 [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|320137839|gb|EFW29744.1| 30S ribosomal protein S11 [Selenomonas artemidis F0399]
          Length = 130

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/127 (52%), Positives = 91/127 (71%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K  +R + + RKNI SG AH+ STFNNT +T+TD  GN ++W+S   +GF GSRK++PFA
Sbjct: 4   KKTTRSKKKVRKNIESGVAHISSTFNNTIVTLTDKSGNALSWASAGGLGFRGSRKSTPFA 63

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  +  A  HG+ S+EV V G GAGR++A+R+L+A G  +  I DVT I HNGCR
Sbjct: 64  AQMAAETAAKAAMEHGLKSVEVFVKGPGAGREAAIRSLQATGLEVNMIKDVTPIPHNGCR 123

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 124 PPKRRRV 130


>gi|300742031|ref|ZP_07072052.1| 30S ribosomal protein S11 [Rothia dentocariosa M567]
 gi|311111945|ref|YP_003983167.1| 30S ribosomal protein S11 [Rothia dentocariosa ATCC 17931]
 gi|300381216|gb|EFJ77778.1| 30S ribosomal protein S11 [Rothia dentocariosa M567]
 gi|310943439|gb|ADP39733.1| 30S ribosomal protein S11 [Rothia dentocariosa ATCC 17931]
          Length = 134

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 90/116 (77%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           KNIV+G+AH+ STFNNT ++ITDP G  I+WSS   +GF GSRK++P+AAQ+A +  + +
Sbjct: 19  KNIVAGQAHIKSTFNNTIVSITDPTGAVISWSSAGDMGFKGSRKSTPYAAQLAAETAANR 78

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           A+ HG+  ++V V G G+GR++A+R+L+A G  + SI DVT +AHNGCRP KRRR+
Sbjct: 79  AKEHGVRKVDVFVKGPGSGRETAIRSLQAAGLEVGSIQDVTPVAHNGCRPPKRRRV 134


>gi|90416839|ref|ZP_01224768.1| ribosomal protein S11 [marine gamma proteobacterium HTCC2207]
 gi|90331186|gb|EAS46430.1| ribosomal protein S11 [marine gamma proteobacterium HTCC2207]
          Length = 130

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 56/113 (49%), Positives = 82/113 (72%)

Query: 17  VSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQN 76
           + G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++PFAAQVA +     A++
Sbjct: 18  IDGVAHIYASFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTPFAAQVAAERAGEAAKD 77

Query: 77  HGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +G+ +L+V+V G G GR+SA+RAL   G+ I +I DVT + HNGCRP K+RR+
Sbjct: 78  YGLKNLDVQVKGPGPGRESAVRALNNAGYKITNITDVTPVPHNGCRPPKKRRV 130


>gi|331702055|ref|YP_004399014.1| 30S ribosomal protein S11 [Lactobacillus buchneri NRRL B-30929]
 gi|329129398|gb|AEB73951.1| 30S ribosomal protein S11 [Lactobacillus buchneri NRRL B-30929]
          Length = 129

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/127 (52%), Positives = 90/127 (70%), Gaps = 1/127 (0%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K  SR R R +KNI +G AH+ STFNNT + ITD  GN ++WSS   +GF GSRK++PFA
Sbjct: 4   KKTSRKR-RAKKNIAAGVAHIHSTFNNTLVMITDTTGNAVSWSSAGALGFRGSRKSTPFA 62

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  +  +  HGM S+EV V G G+GR++A+RAL+A G  + +I DVT + HNG R
Sbjct: 63  AQMAAEAAAKASMEHGMKSVEVAVKGPGSGREAAIRALQATGLEVTAIRDVTPVPHNGSR 122

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 123 PPKRRRV 129


>gi|317485798|ref|ZP_07944662.1| 30S ribosomal protein S11 [Bilophila wadsworthia 3_1_6]
 gi|316922904|gb|EFV44126.1| 30S ribosomal protein S11 [Bilophila wadsworthia 3_1_6]
          Length = 129

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 92/126 (73%), Gaps = 1/126 (0%)

Query: 5   PSRI-RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAA 63
           P R+ + RE+KN+  G AH+ ++FNNT IT TD  GNT++W+S    GF GSRK++PFAA
Sbjct: 4   PKRVAKKREKKNVPLGVAHIQASFNNTIITFTDTRGNTVSWASAGQSGFKGSRKSTPFAA 63

Query: 64  QVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRP 123
           QVA +  + KAQ++GM ++ + V G G+GR++A+RA+ A GF +  I DVT I HNGCRP
Sbjct: 64  QVAAEQAARKAQDNGMRTVGIYVKGPGSGREAAMRAINAAGFKVAFIRDVTPIPHNGCRP 123

Query: 124 RKRRRI 129
            KRRR+
Sbjct: 124 PKRRRV 129


>gi|94987422|ref|YP_595355.1| 30S ribosomal protein S11 [Lawsonia intracellularis PHE/MN1-00]
 gi|123082135|sp|Q1MPP3|RS11_LAWIP RecName: Full=30S ribosomal protein S11
 gi|94731671|emb|CAJ55034.1| ribosomal protein S11 [Lawsonia intracellularis PHE/MN1-00]
          Length = 129

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/126 (53%), Positives = 93/126 (73%), Gaps = 1/126 (0%)

Query: 5   PSRI-RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAA 63
           P RI + RE+KNI  G  H+ ++FNNT IT TDP GNTI+W+S    GF GSRK++PFAA
Sbjct: 4   PKRIGKKREKKNIPVGVVHIQASFNNTIITFTDPRGNTISWASSGQSGFKGSRKSTPFAA 63

Query: 64  QVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRP 123
           QVA +  + +AQ++GM ++ + V G G+GR+SA+RA+ A+GF +  I D+T I HNGCRP
Sbjct: 64  QVAAEQAARRAQDNGMRTVGIYVKGPGSGRESAMRAINAVGFKVAFIRDITPIPHNGCRP 123

Query: 124 RKRRRI 129
            KRRR+
Sbjct: 124 PKRRRV 129


>gi|50364964|ref|YP_053389.1| 30S ribosomal protein S11 [Mesoplasma florum L1]
 gi|59798693|sp|Q6F1W8|RS11_MESFL RecName: Full=30S ribosomal protein S11
 gi|50363520|gb|AAT75505.1| 30S ribosomal protein S11 [Mesoplasma florum L1]
          Length = 130

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 84/120 (70%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +KNI  G AH+ STFNNT +TI+D  GN ++WSS   +GF GS+K++P+AAQ+ ++
Sbjct: 10  KKRIKKNIPKGIAHIHSTFNNTIVTISDEKGNVLSWSSAGAIGFKGSKKSTPYAAQMISE 69

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A + G+ S++V+V G G GRD+A+RAL  +G  + SI D T I HNG RP+KR R
Sbjct: 70  AAAKGAMDQGVKSVQVEVKGPGPGRDAAVRALTIVGMEVTSIKDCTPIPHNGVRPKKRPR 129


>gi|309789645|ref|ZP_07684226.1| ribosomal protein S11 [Oscillochloris trichoides DG6]
 gi|308228381|gb|EFO82028.1| ribosomal protein S11 [Oscillochloris trichoides DG6]
          Length = 107

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 78/107 (72%)

Query: 23  VVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSL 82
           ++STFNNT +TITDP G  + W+S    GF GSRK++P+AAQ+  D  + KA  +GM S+
Sbjct: 1   MLSTFNNTIVTITDPSGAVVCWASAGQGGFKGSRKSTPYAAQITADSAARKAMENGMRSI 60

Query: 83  EVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           EV V G G+GR++A+R+L+A G  + SI DVT I HNGCRP KRRR+
Sbjct: 61  EVFVKGPGSGREAAIRSLQAAGLQVTSITDVTPIPHNGCRPPKRRRV 107


>gi|257454069|ref|ZP_05619343.1| 30S ribosomal protein S11 [Enhydrobacter aerosaccus SK60]
 gi|257448547|gb|EEV23516.1| 30S ribosomal protein S11 [Enhydrobacter aerosaccus SK60]
          Length = 129

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 84/117 (71%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           R+++  G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++PFAAQVA +    
Sbjct: 13  RRSVAEGVAHIHASFNNTIVTITDRQGNALAWATAGGQGFRGSRKSTPFAAQVAAEVAGK 72

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            AQ +G+ +++V V G G GR+SA+RAL A+G+ I SI D+T I HNG RP K+RR+
Sbjct: 73  AAQEYGVKNVDVLVKGPGPGRESAVRALGALGYKINSISDITPIPHNGTRPPKKRRV 129


>gi|269796228|ref|YP_003315683.1| 30S ribosomal protein S11P [Sanguibacter keddieii DSM 10542]
 gi|269098413|gb|ACZ22849.1| SSU ribosomal protein S11P [Sanguibacter keddieii DSM 10542]
          Length = 135

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 66/127 (51%), Positives = 94/127 (74%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           +S  + R +++KN+  G+AH+ STFNNT ++ITDP G  I+W+S   VGF GSRK++PFA
Sbjct: 9   QSARKPRRKDKKNVAIGQAHIKSTFNNTIVSITDPTGAVISWASSGQVGFKGSRKSTPFA 68

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  + +AQ HGM  ++V V G G+GR++A+R+L+A G  + SI DVT  AHNGCR
Sbjct: 69  AQLAAEAAARRAQEHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVGSIQDVTPQAHNGCR 128

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 129 PPKRRRV 135


>gi|307718229|ref|YP_003873761.1| 30S ribosomal protein S11 [Spirochaeta thermophila DSM 6192]
 gi|306531954|gb|ADN01488.1| 30S ribosomal protein S11 [Spirochaeta thermophila DSM 6192]
          Length = 123

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 85/121 (70%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + +E++ +  G+ ++ +TFNNT +T+TD +GN ++W+S   +GF G++K++P+AAQV  +
Sbjct: 3   KKKEKRTVYEGKVYIQATFNNTIVTVTDMNGNCVSWASAGALGFRGAKKSTPYAAQVTAE 62

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
               KA +HG+    V V G G GR++A+RA+ A+G  + S+ D+T I HNGCRPRK RR
Sbjct: 63  TAVKKAMDHGLQEAHVYVKGPGVGREAAIRAIDALGVRVRSLHDITPIPHNGCRPRKARR 122

Query: 129 I 129
           +
Sbjct: 123 V 123


>gi|269955461|ref|YP_003325250.1| 30S ribosomal protein S11 [Xylanimonas cellulosilytica DSM 15894]
 gi|269304142|gb|ACZ29692.1| ribosomal protein S11 [Xylanimonas cellulosilytica DSM 15894]
          Length = 135

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +++KN+  G+AH+ STFNNT ++ITDP G  IAW+S   VGF GSRK++PFAAQ+A +
Sbjct: 15  RRKDKKNVPLGQAHIKSTFNNTIVSITDPTGAVIAWASAGHVGFKGSRKSTPFAAQLAAE 74

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + +AQ HG+  ++V V G G+GR++A+R+L+A G  + SI DVT  AHNG RP KRRR
Sbjct: 75  SAARRAQEHGVKKVDVFVKGPGSGRETAIRSLQATGLEVGSIQDVTPQAHNGVRPPKRRR 134

Query: 129 I 129
           +
Sbjct: 135 V 135


>gi|227497207|ref|ZP_03927455.1| ribosomal protein S11 [Actinomyces urogenitalis DSM 15434]
 gi|226833338|gb|EEH65721.1| ribosomal protein S11 [Actinomyces urogenitalis DSM 15434]
          Length = 133

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 91/121 (75%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R ++RKN+  G A++ STFNNT +++TDP+G  IAW+S   VGF GSRK++P+AAQ+A +
Sbjct: 13  RRKDRKNVTHGHAYIKSTFNNTIVSLTDPNGAVIAWASSGQVGFKGSRKSTPYAAQLAAE 72

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + +AQ HGM  ++V V G G+GR++A+R+L+A G  + SI DVT  AHNGCRP KRRR
Sbjct: 73  AAARRAQEHGMKKIDVFVKGPGSGRETAIRSLQAAGLEVGSITDVTPQAHNGCRPPKRRR 132

Query: 129 I 129
           +
Sbjct: 133 V 133


>gi|4098575|gb|AAD00323.1| ribosomal protein S11 [Xanthomonas campestris pv. campestris]
          Length = 130

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 81/114 (71%)

Query: 16  IVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQ 75
           I  G AHV ++FNNT +TITD  GN ++W++    GF GSRK++PFAAQVA +       
Sbjct: 17  ITDGVAHVHASFNNTIVTITDRQGNALSWATSGGAGFRGSRKSTPFAAQVAAEKAGRAGL 76

Query: 76  NHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           ++G+ SLEV++ G G GR+SA+R+L  +G+ I +I DVT I HNGCRP K+RR+
Sbjct: 77  DYGVKSLEVRIKGPGPGRESAVRSLNNVGYKITNIIDVTPIPHNGCRPPKKRRV 130


>gi|227871776|ref|ZP_03990181.1| ribosomal protein S11 [Oribacterium sinus F0268]
 gi|227842377|gb|EEJ52602.1| ribosomal protein S11 [Oribacterium sinus F0268]
          Length = 131

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 82/115 (71%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G+AH+ S+FNNT +T+TD  GN ++W+S   +GF GSRK++P+AAQ+A +     A
Sbjct: 17  NVERGQAHIQSSFNNTIVTLTDAQGNALSWASAGGLGFRGSRKSTPYAAQMAAETAVKAA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+  ++V V G G+GR++A+RAL A G  + SI DVT + HNGCRP KRRR+
Sbjct: 77  LVHGLKYVDVMVKGPGSGREAAIRALAANGLEVTSIKDVTPVPHNGCRPPKRRRV 131


>gi|169335655|ref|ZP_02862848.1| hypothetical protein ANASTE_02075 [Anaerofustis stercorihominis DSM
           17244]
 gi|169258393|gb|EDS72359.1| hypothetical protein ANASTE_02075 [Anaerofustis stercorihominis DSM
           17244]
          Length = 131

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 86/115 (74%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI  G+AH+ STFNNT +T+TD  GN +AWSS   +GF GSRK++P+AAQ A  + + +A
Sbjct: 17  NIEKGQAHIRSTFNNTIVTLTDVAGNALAWSSAGELGFKGSRKSTPYAAQSAATEAAKRA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ +++V V G G+GR++A+RAL+A G  ++SI DVT I HNGCRP KRRR+
Sbjct: 77  MEHGLKTIDVFVKGPGSGREAAIRALQAAGLNVISIKDVTPIPHNGCRPPKRRRV 131


>gi|238752668|ref|ZP_04614139.1| 30S ribosomal protein S11 [Yersinia rohdei ATCC 43380]
 gi|238754195|ref|ZP_04615553.1| 30S ribosomal protein S11 [Yersinia ruckeri ATCC 29473]
 gi|260599617|ref|YP_003212188.1| 30S ribosomal protein S11 [Cronobacter turicensis z3032]
 gi|238707691|gb|EEQ00051.1| 30S ribosomal protein S11 [Yersinia ruckeri ATCC 29473]
 gi|238709095|gb|EEQ01342.1| 30S ribosomal protein S11 [Yersinia rohdei ATCC 43380]
 gi|260218794|emb|CBA34142.1| 30S ribosomal protein S11 [Cronobacter turicensis z3032]
 gi|304560336|gb|ADM43000.1| SSU ribosomal protein S11p (S14e) [Edwardsiella tarda FL6-60]
          Length = 110

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 78/109 (71%)

Query: 21  AHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMS 80
           AH+ ++FNNT +TITD  GN + W++    GF GSRK++PFAAQVA + C+   + +G+ 
Sbjct: 2   AHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCAEAVKEYGIK 61

Query: 81  SLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +LEV V G G GR+S +RAL A GF I +I DVT I HNGCRP K+RR+
Sbjct: 62  NLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV 110


>gi|258651410|ref|YP_003200566.1| 30S ribosomal protein S11 [Nakamurella multipartita DSM 44233]
 gi|258554635|gb|ACV77577.1| ribosomal protein S11 [Nakamurella multipartita DSM 44233]
          Length = 136

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 91/123 (73%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           +IR +E+KN+  G AH+ STFNNT ++ITDP G  I+W+S   VGF GSRK++PFAAQ+A
Sbjct: 14  KIRRKEKKNVSHGHAHIKSTFNNTIVSITDPTGAVISWASAGHVGFKGSRKSTPFAAQMA 73

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            ++ + +A  HGM  ++V V G G+GR++A+R+L+A G  + +I DVT  AHNG RP KR
Sbjct: 74  AENAARQAIEHGMRKVDVFVKGPGSGRETAIRSLQAAGLEVGAISDVTPQAHNGTRPPKR 133

Query: 127 RRI 129
           RR+
Sbjct: 134 RRV 136


>gi|163790169|ref|ZP_02184603.1| 30S ribosomal protein S11 [Carnobacterium sp. AT7]
 gi|328958704|ref|YP_004376090.1| 30S ribosomal protein S11 [Carnobacterium sp. 17-4]
 gi|159874660|gb|EDP68730.1| 30S ribosomal protein S11 [Carnobacterium sp. AT7]
 gi|328675028|gb|AEB31074.1| 30S ribosomal protein S11 [Carnobacterium sp. 17-4]
          Length = 128

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 93/129 (72%), Gaps = 1/129 (0%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K  +R R R +KN+ SG AH+ STFNNT + ITD HGN I+WSS   +GF GS+K++P
Sbjct: 1   MAKKVTRKR-RVKKNVESGVAHIRSTFNNTIVMITDVHGNAISWSSAGALGFRGSKKSTP 59

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  +  +  +GM ++EV V G G+GR++A+R+L+A G  + +I DVT I HNG
Sbjct: 60  FAAQMAAEAAAKVSMENGMKTVEVAVKGPGSGREAAIRSLQATGLEVTAIRDVTPIPHNG 119

Query: 121 CRPRKRRRI 129
           CRP KRRR+
Sbjct: 120 CRPPKRRRV 128


>gi|22297648|ref|NP_680895.1| 30S ribosomal protein S11 [Thermosynechococcus elongatus BP-1]
 gi|48474283|sp|P59379|RS11_THEEB RecName: Full=30S ribosomal protein S11
 gi|22293825|dbj|BAC07657.1| 30S ribosomal protein S11 [Thermosynechococcus elongatus BP-1]
          Length = 130

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/119 (53%), Positives = 88/119 (73%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           ++++N+ SG AH+ STFNNT ++ITDP+G  IAW+S    GF G++K +PFAAQ A D+ 
Sbjct: 12  KQKRNVPSGVAHIQSTFNNTIVSITDPNGEVIAWASAGSSGFKGAKKGTPFAAQTAADNA 71

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + +A + GM  +EV VSG G+GR++A+RAL+A G  I  I DVT I HNGCRP KRRR+
Sbjct: 72  ARRAIDQGMRQIEVMVSGPGSGRETAIRALQAAGLEITLIRDVTPIPHNGCRPPKRRRV 130


>gi|320108370|ref|YP_004183960.1| 30S ribosomal protein S11 [Terriglobus saanensis SP1PR4]
 gi|319926891|gb|ADV83966.1| 30S ribosomal protein S11 [Terriglobus saanensis SP1PR4]
          Length = 141

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 87/119 (73%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           RERKN+  G   V +TFNNT +TITD  GNT++W S   +GF GSRK +PFAAQ A  + 
Sbjct: 23  RERKNVPYGLVFVQATFNNTIVTITDQTGNTLSWKSSGSLGFRGSRKGTPFAAQQAAVNA 82

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +  A++HG+ S++V+VSG G+GR+SA+RAL A G  + SI DVT I HNGCRP KRRR+
Sbjct: 83  ATAARDHGLRSVDVRVSGPGSGRESAVRALAAAGLDVRSIRDVTPIPHNGCRPPKRRRV 141


>gi|319952172|ref|YP_004163439.1| ssu ribosomal protein s11p [Cellulophaga algicola DSM 14237]
 gi|319420832|gb|ADV47941.1| SSU ribosomal protein S11P [Cellulophaga algicola DSM 14237]
          Length = 130

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 90/131 (68%), Gaps = 3/131 (2%)

Query: 1   MPKSPSRIRNRERKNIVS--GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKN 58
           M KS +++  ++RK IV   G AHV ++FNN  I++T+  G+ I+WSS   +GF GS+KN
Sbjct: 1   MAKSNTKVA-KKRKVIVESVGEAHVTASFNNIIISLTNKKGDVISWSSAGKMGFRGSKKN 59

Query: 59  SPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAH 118
           +P+AAQ+A++DC+  A   G+  ++V V G G GR+SA+R+L   G  +  I DVT I H
Sbjct: 60  TPYAAQIASEDCAKVAHEAGLRKVKVYVKGPGNGRESAIRSLHNAGIEVTEIIDVTPIPH 119

Query: 119 NGCRPRKRRRI 129
           NGCRP KRRR+
Sbjct: 120 NGCRPPKRRRV 130


>gi|158317766|ref|YP_001510274.1| 30S ribosomal protein S11 [Frankia sp. EAN1pec]
 gi|226708373|sp|A8LB07|RS11_FRASN RecName: Full=30S ribosomal protein S11
 gi|158113171|gb|ABW15368.1| ribosomal protein S11 [Frankia sp. EAN1pec]
          Length = 134

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 63/115 (54%), Positives = 86/115 (74%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++PFAAQ+A ++ + KA
Sbjct: 20  NVAHGHAHIKSTFNNTIVSITDPSGNVISWASAGHVGFKGSRKSTPFAAQMAAENAARKA 79

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           Q HGM  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGCRP KRRR+
Sbjct: 80  QEHGMRKVDVFVKGPGSGRETAIRSLQAAGLEVGAIQDVTPTPHNGCRPPKRRRV 134


>gi|83815931|ref|YP_445190.1| 30S ribosomal protein S11 [Salinibacter ruber DSM 13855]
 gi|83757325|gb|ABC45438.1| 30S ribosomal protein S11 [Salinibacter ruber DSM 13855]
          Length = 158

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 87/124 (70%), Gaps = 3/124 (2%)

Query: 9   RNRERKNIV---SGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           R  ++KN+V   +GRA+V +TFNN  +T+TD +GNTI+W+S   +GF GSRKN+P+AAQ 
Sbjct: 35  RTPQKKNVVVESNGRAYVKATFNNVIVTLTDQYGNTISWASAGKMGFKGSRKNTPYAAQK 94

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  + +A   G+  ++V V G G+GR+ A+RA+   G  + SI DVT + HNGCRP K
Sbjct: 95  AGESAANEAYELGLRRVDVYVKGPGSGREGAIRAMSESGLEVASIRDVTPLPHNGCRPPK 154

Query: 126 RRRI 129
           RRR+
Sbjct: 155 RRRV 158


>gi|307720211|ref|YP_003891351.1| 30S ribosomal protein S11P [Sulfurimonas autotrophica DSM 16294]
 gi|306978304|gb|ADN08339.1| SSU ribosomal protein S11P [Sulfurimonas autotrophica DSM 16294]
          Length = 130

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 82/116 (70%), Gaps = 1/116 (0%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI  G  H+ ++FNNT +TITD  GN IAWSS   +GF GS+K++PFAAQ A +D  AKA
Sbjct: 15  NISRGIVHIAASFNNTLVTITDEMGNMIAWSSAGSLGFKGSKKSTPFAAQAAVEDAVAKA 74

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAI-GFTIVSICDVTMIAHNGCRPRKRRRI 129
           Q HG+  L +KV G G+GR++A++A+ AI G  +  + DVT + HNGCR  KRRR+
Sbjct: 75  QVHGIKELGIKVQGPGSGRETAVKAVGAIEGIRVTFMKDVTPLPHNGCRAPKRRRV 130


>gi|237749538|ref|ZP_04580018.1| small subunit ribosomal protein S11 [Oxalobacter formigenes OXCC13]
 gi|229380900|gb|EEO30991.1| small subunit ribosomal protein S11 [Oxalobacter formigenes OXCC13]
          Length = 133

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 86/124 (69%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R+R + ++NI  G  HV ++FNNT ITITD  GN + W++    GF GSRK++PFAAQV
Sbjct: 10  ARVRKKVKRNIAEGVVHVHASFNNTIITITDRQGNALTWATSGGAGFKGSRKSTPFAAQV 69

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +     AQ +G+ +LEVK+ G G GR+SA+RAL  +G  I  I D+T I HNGCRP K
Sbjct: 70  AAEAAGKVAQEYGIKTLEVKIKGPGPGRESAVRALNNLGIRITQIQDITPIPHNGCRPPK 129

Query: 126 RRRI 129
           RRRI
Sbjct: 130 RRRI 133


>gi|302876507|ref|YP_003845140.1| 30S ribosomal protein S11 [Clostridium cellulovorans 743B]
 gi|307687179|ref|ZP_07629625.1| 30S ribosomal protein S11 [Clostridium cellulovorans 743B]
 gi|302579364|gb|ADL53376.1| 30S ribosomal protein S11 [Clostridium cellulovorans 743B]
          Length = 131

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 84/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G AH+ STFNN+ +T+TD HGN ++WSS   +GF GSRK++PFAAQ+A +  +  A
Sbjct: 17  NVEHGAAHIKSTFNNSIVTLTDAHGNALSWSSSGALGFRGSRKSTPFAAQMAAETAAKVA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ S+EV V G GAGR++A+R+L+A G  +  I DVT I HNGCRP KRRR+
Sbjct: 77  MEHGLKSVEVYVKGPGAGREAAIRSLQAAGLEVTLIKDVTPIPHNGCRPPKRRRV 131


>gi|227832271|ref|YP_002833978.1| 30S ribosomal protein S11 [Corynebacterium aurimucosum ATCC 700975]
 gi|262183873|ref|ZP_06043294.1| 30S ribosomal protein S11 [Corynebacterium aurimucosum ATCC 700975]
 gi|254765377|sp|C3PL36|RS11_CORA7 RecName: Full=30S ribosomal protein S11
 gi|227453287|gb|ACP32040.1| 30S ribosomal protein S11 [Corynebacterium aurimucosum ATCC 700975]
          Length = 134

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 88/117 (75%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KN+ +G A++ STFNNT ++ITDPHG  I+W+S   VGF GSRK++PFAAQ+A ++ + 
Sbjct: 18  KKNVAAGHAYIKSTFNNTIVSITDPHGAVISWASSGHVGFKGSRKSTPFAAQMAAENAAR 77

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           KA +HGM  ++V V G G+GR++A+R+L+A G  + SI D T   HNGCRP KRR++
Sbjct: 78  KAMDHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVSSITDATPQPHNGCRPTKRRKV 134


>gi|255326870|ref|ZP_05367946.1| 30S ribosomal protein S11 [Rothia mucilaginosa ATCC 25296]
 gi|283457575|ref|YP_003362158.1| 30S ribosomal protein S11 [Rothia mucilaginosa DY-18]
 gi|255296087|gb|EET75428.1| 30S ribosomal protein S11 [Rothia mucilaginosa ATCC 25296]
 gi|283133573|dbj|BAI64338.1| ribosomal protein S11 [Rothia mucilaginosa DY-18]
          Length = 135

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 92/121 (76%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +  KNIV+G+AH+ STFNNT ++ITDP G  I+WSS   +GF GSRK++P+AAQ+A +
Sbjct: 15  RRKVSKNIVAGQAHIKSTFNNTIVSITDPTGAVISWSSAGDMGFKGSRKSTPYAAQLAAE 74

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + +A+ HG+  ++V V G G+GR++A+R+L+A G  + SI DVT +AHNGCRP KRRR
Sbjct: 75  AAANRAKEHGVRKVDVFVKGPGSGRETAIRSLQAAGLEVGSIQDVTPVAHNGCRPPKRRR 134

Query: 129 I 129
           +
Sbjct: 135 V 135


>gi|293977952|ref|YP_003543382.1| 30S ribosomal protein S11P [Candidatus Sulcia muelleri DMIN]
 gi|292667883|gb|ADE35518.1| SSU ribosomal protein S11P [Candidatus Sulcia muelleri DMIN]
          Length = 130

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 77/111 (69%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G AH+ ST+NN  IT+T+  G+ IAWSS   +GF GS+KN+P+AAQ+  +D + K  N G
Sbjct: 20  GEAHIKSTYNNIIITLTNKKGDVIAWSSAGKMGFKGSKKNTPYAAQITAEDVAEKGLNAG 79

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +  LEV V G GAGRD+A+RAL      ++ I D+T I HNGCRP K+RRI
Sbjct: 80  IKKLEVIVKGPGAGRDAAIRALVNKNLILLVIKDITPIPHNGCRPPKKRRI 130


>gi|295396440|ref|ZP_06806602.1| 30S ribosomal protein S11 [Brevibacterium mcbrellneri ATCC 49030]
 gi|294970742|gb|EFG46655.1| 30S ribosomal protein S11 [Brevibacterium mcbrellneri ATCC 49030]
          Length = 133

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/120 (50%), Positives = 91/120 (75%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R + +K++V+G+AH+ STFNNT ++ITDP G  I+W+S   VGF GSRK++P+AAQ+A +
Sbjct: 13  RRKVKKSVVNGQAHIKSTFNNTIVSITDPTGAVISWASSGEVGFKGSRKSTPYAAQMAAE 72

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + +AQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT + HNGCRP KRRR
Sbjct: 73  SAARRAQEHGLKKVDVFVKGPGSGRETAIRSLQAAGLELGTIQDVTPVPHNGCRPPKRRR 132


>gi|42526302|ref|NP_971400.1| 30S ribosomal protein S11 [Treponema denticola ATCC 35405]
 gi|59798794|sp|Q73PK9|RS11_TREDE RecName: Full=30S ribosomal protein S11
 gi|41816414|gb|AAS11281.1| ribosomal protein S11 [Treponema denticola ATCC 35405]
 gi|325473245|gb|EGC76440.1| 30S ribosomal protein S11 [Treponema denticola F0402]
          Length = 126

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 82/121 (67%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + +E+K+I  G  ++ +TFNNT ITITD  GN ++W+S   +GF+G++K++PFAAQ   +
Sbjct: 6   KRKEKKSIYEGNVYIQATFNNTIITITDLKGNVLSWASSGGLGFAGAKKSTPFAAQTVAE 65

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
               K Q +G+  + V V G G GR+SA+R L  +G  + SI DVT I HNGCRP+K RR
Sbjct: 66  TAVQKCQPYGLHEVHVFVKGPGVGRESAIRTLGTMGLKVRSISDVTPIPHNGCRPKKTRR 125

Query: 129 I 129
           I
Sbjct: 126 I 126


>gi|29839881|ref|NP_828987.1| 30S ribosomal protein S11 [Chlamydophila caviae GPIC]
 gi|33301632|sp|Q824N2|RS11_CHLCV RecName: Full=30S ribosomal protein S11
 gi|29834228|gb|AAP04865.1| ribosomal protein S11 [Chlamydophila caviae GPIC]
          Length = 132

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 87/122 (71%)

Query: 8   IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
           ++ ++ KNI SG  HV +TFNNT ++ITDP GNTI+W+S   VG+SGSRK+S FAA +A 
Sbjct: 11  VKRKQLKNIPSGVVHVKATFNNTIVSITDPAGNTISWASAGKVGYSGSRKSSAFAATMAA 70

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
            D +  A N G+  +EV + G GAGR+SA+RAL A G  +  I D T + HNGCRPRKRR
Sbjct: 71  QDAAKNAMNSGLKEVEVCLKGTGAGRESAVRALIASGLVVSVIRDETPVPHNGCRPRKRR 130

Query: 128 RI 129
           R+
Sbjct: 131 RV 132


>gi|152964683|ref|YP_001360467.1| 30S ribosomal protein S11 [Kineococcus radiotolerans SRS30216]
 gi|189040419|sp|A6W5W4|RS11_KINRD RecName: Full=30S ribosomal protein S11
 gi|151359200|gb|ABS02203.1| ribosomal protein S11 [Kineococcus radiotolerans SRS30216]
          Length = 135

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +E+KN+  G AH+ STFNNT ++ITDP G  IAW+S   VGF GSRK++PFAAQ+A +
Sbjct: 15  RRKEKKNVAHGHAHIKSTFNNTIVSITDPTGAVIAWASAGQVGFKGSRKSTPFAAQMAAE 74

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + +AQ HGM  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGCRP KRRR
Sbjct: 75  AAARRAQEHGMRKVDVFVKGPGSGRETAIRSLQATGLEVGAIQDVTPSPHNGCRPPKRRR 134

Query: 129 I 129
           +
Sbjct: 135 V 135


>gi|259500917|ref|ZP_05743819.1| 30S ribosomal protein S11 [Lactobacillus iners DSM 13335]
 gi|302190630|ref|ZP_07266884.1| 30S ribosomal protein S11 [Lactobacillus iners AB-1]
 gi|309803674|ref|ZP_07697764.1| 30S ribosomal protein S11 [Lactobacillus iners LactinV 11V1-d]
 gi|309804977|ref|ZP_07699035.1| 30S ribosomal protein S11 [Lactobacillus iners LactinV 09V1-c]
 gi|309806718|ref|ZP_07700713.1| 30S ribosomal protein S11 [Lactobacillus iners LactinV 03V1-b]
 gi|309808406|ref|ZP_07702305.1| 30S ribosomal protein S11 [Lactobacillus iners LactinV 01V1-a]
 gi|309809124|ref|ZP_07702997.1| 30S ribosomal protein S11 [Lactobacillus iners SPIN 2503V10-D]
 gi|312871304|ref|ZP_07731402.1| 30S ribosomal protein S11 [Lactobacillus iners LEAF 3008A-a]
 gi|312872672|ref|ZP_07732737.1| 30S ribosomal protein S11 [Lactobacillus iners LEAF 2062A-h1]
 gi|312874058|ref|ZP_07734093.1| 30S ribosomal protein S11 [Lactobacillus iners LEAF 2052A-d]
 gi|312874956|ref|ZP_07734975.1| 30S ribosomal protein S11 [Lactobacillus iners LEAF 2053A-b]
 gi|315654001|ref|ZP_07906917.1| 30S ribosomal protein S11 [Lactobacillus iners ATCC 55195]
 gi|325912334|ref|ZP_08174730.1| 30S ribosomal protein S11 [Lactobacillus iners UPII 143-D]
 gi|325913207|ref|ZP_08175576.1| 30S ribosomal protein S11 [Lactobacillus iners UPII 60-B]
 gi|329920632|ref|ZP_08277319.1| 30S ribosomal protein S11 [Lactobacillus iners SPIN 1401G]
 gi|259167611|gb|EEW52106.1| 30S ribosomal protein S11 [Lactobacillus iners DSM 13335]
 gi|308164272|gb|EFO66529.1| 30S ribosomal protein S11 [Lactobacillus iners LactinV 11V1-d]
 gi|308165737|gb|EFO67962.1| 30S ribosomal protein S11 [Lactobacillus iners LactinV 09V1-c]
 gi|308166898|gb|EFO69082.1| 30S ribosomal protein S11 [Lactobacillus iners LactinV 03V1-b]
 gi|308168234|gb|EFO70353.1| 30S ribosomal protein S11 [Lactobacillus iners LactinV 01V1-a]
 gi|308170569|gb|EFO72589.1| 30S ribosomal protein S11 [Lactobacillus iners SPIN 2503V10-D]
 gi|311089701|gb|EFQ48126.1| 30S ribosomal protein S11 [Lactobacillus iners LEAF 2053A-b]
 gi|311090398|gb|EFQ48807.1| 30S ribosomal protein S11 [Lactobacillus iners LEAF 2052A-d]
 gi|311091714|gb|EFQ50093.1| 30S ribosomal protein S11 [Lactobacillus iners LEAF 2062A-h1]
 gi|311093318|gb|EFQ51664.1| 30S ribosomal protein S11 [Lactobacillus iners LEAF 3008A-a]
 gi|315488697|gb|EFU78343.1| 30S ribosomal protein S11 [Lactobacillus iners ATCC 55195]
 gi|325475805|gb|EGC78975.1| 30S ribosomal protein S11 [Lactobacillus iners UPII 143-D]
 gi|325477471|gb|EGC80614.1| 30S ribosomal protein S11 [Lactobacillus iners UPII 60-B]
 gi|328935890|gb|EGG32350.1| 30S ribosomal protein S11 [Lactobacillus iners SPIN 1401G]
          Length = 129

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 86/121 (71%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +K++ SG AH+ STFNNT + ITD  GN +AWSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVKKHVESGVAHIHSTFNNTLVMITDVQGNAVAWSSAGALGFKGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A + GM  +EV V G GAGR++A+RAL+A G  I +I DVT + HNG RP KRRR
Sbjct: 69  AATKTAMDQGMKHVEVSVKGPGAGREAAIRALQATGLEITAIRDVTPVPHNGSRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|88803726|ref|ZP_01119250.1| 30S ribosomal protein S11 [Polaribacter irgensii 23-P]
 gi|88780459|gb|EAR11640.1| 30S ribosomal protein S11 [Polaribacter irgensii 23-P]
          Length = 127

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 86/122 (70%), Gaps = 2/122 (1%)

Query: 10  NRERKNIVS--GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
           +++RK I+   G AHV ++FNN  I++T+  G+ I+WSS   +GF GS+KN+P+AAQ+A 
Sbjct: 6   SKKRKVIIDAVGEAHVTASFNNIIISLTNKKGDVISWSSAGKMGFRGSKKNTPYAAQLAA 65

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
           +DCSA A+  G+  ++V V G G GR+SA+R++   G  +  I DVT I HNGCRP KRR
Sbjct: 66  EDCSAVAKEAGLRKVKVYVKGPGNGRESAIRSIHNAGIEVTEIIDVTPIPHNGCRPPKRR 125

Query: 128 RI 129
           R+
Sbjct: 126 RV 127


>gi|260907115|ref|ZP_05915437.1| SSU ribosomal protein S11P [Brevibacterium linens BL2]
          Length = 134

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 62/120 (51%), Positives = 90/120 (75%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R + +KNIV+G+AH+ STFNNT ++ITDP G  I+W+S   VGF GSRK++P+AAQ+A +
Sbjct: 14  RRKLKKNIVAGQAHIKSTFNNTIVSITDPTGAVISWASSGEVGFKGSRKSTPYAAQMAAE 73

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + +AQ HG+  ++V V G G+GR++A+R+L+A G  + +I DVT +  NGCRP KRRR
Sbjct: 74  SAARRAQEHGLKKVDVFVKGPGSGRETAIRSLQAAGLELGTIQDVTPVPFNGCRPTKRRR 133


>gi|294507074|ref|YP_003571132.1| 30S ribosomal protein S11 [Salinibacter ruber M8]
 gi|294343402|emb|CBH24180.1| 30S ribosomal protein S11 [Salinibacter ruber M8]
          Length = 134

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 86/124 (69%), Gaps = 3/124 (2%)

Query: 9   RNRERKNIV---SGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           R   +KN+V   +GRA+V +TFNN  +T+TD +GNTI+W+S   +GF GSRKN+P+AAQ 
Sbjct: 11  RTPRKKNVVVESNGRAYVKATFNNVIVTLTDQYGNTISWASAGKMGFKGSRKNTPYAAQK 70

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  + +A   G+  ++V V G G+GR+ A+RA+   G  + SI DVT + HNGCRP K
Sbjct: 71  AGESAANEAYELGLRRVDVYVKGPGSGREGAIRAMSESGLEVASIRDVTPLPHNGCRPPK 130

Query: 126 RRRI 129
           RRR+
Sbjct: 131 RRRV 134


>gi|259047530|ref|ZP_05737931.1| 30S ribosomal protein S11 [Granulicatella adiacens ATCC 49175]
 gi|260584441|ref|ZP_05852188.1| 30S ribosomal protein S11 [Granulicatella elegans ATCC 700633]
 gi|259035721|gb|EEW36976.1| 30S ribosomal protein S11 [Granulicatella adiacens ATCC 49175]
 gi|260157959|gb|EEW93028.1| 30S ribosomal protein S11 [Granulicatella elegans ATCC 700633]
          Length = 128

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 85/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI SG AH+ STFNNT + ITD HGN ++WSS   +GF GS+K++PFAAQ+A +  +  +
Sbjct: 14  NIESGVAHIRSTFNNTIVMITDVHGNAVSWSSAGALGFKGSKKSTPFAAQMAAESAAKGS 73

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HGM ++EV V G G+GR++A+R+L+A G  + +I DVT I HNGCRP KRRR+
Sbjct: 74  MEHGMKTVEVSVKGPGSGREAAIRSLQATGLEVTAIRDVTPIPHNGCRPPKRRRV 128


>gi|104773567|ref|YP_618547.1| 30S ribosomal protein S11 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116513564|ref|YP_812470.1| 30S ribosomal protein S11 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|122275666|sp|Q04BZ0|RS11_LACDB RecName: Full=30S ribosomal protein S11
 gi|122984008|sp|Q1GBJ3|RS11_LACDA RecName: Full=30S ribosomal protein S11
 gi|103422648|emb|CAI97256.1| 30S ribosomal protein S11 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116092879|gb|ABJ58032.1| SSU ribosomal protein S11P [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|325125199|gb|ADY84529.1| 30S ribosomal protein S11 [Lactobacillus delbrueckii subsp.
           bulgaricus 2038]
          Length = 129

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           MP   +  + R +K++ SG AH+ STFNNT + ITD  GN +AWSS   +GF GSRK++P
Sbjct: 1   MPAKKTAHKRRVKKHVESGVAHIHSTFNNTLVMITDVQGNAVAWSSAGALGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  +  A + GM  +EV V G G+GR+SA+RAL+A G  I SI DVT + HNG
Sbjct: 61  FAAQMAAEAAAKSAIDQGMKHIEVSVKGPGSGRESAIRALQAAGLEITSIRDVTPVPHNG 120

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 121 SRPPKRRRV 129


>gi|329942431|ref|ZP_08291241.1| ribosomal S11 family protein [Chlamydophila psittaci Cal10]
 gi|313847668|emb|CBY16656.1| putative 30s ribosomal protein s11 [Chlamydophila psittaci RD1]
 gi|325506589|gb|ADZ18227.1| 30S ribosomal protein S11 [Chlamydophila psittaci 6BC]
 gi|328815341|gb|EGF85329.1| ribosomal S11 family protein [Chlamydophila psittaci Cal10]
 gi|328914305|gb|AEB55138.1| ribosomal protein S11 [Chlamydophila psittaci 6BC]
          Length = 132

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 67/122 (54%), Positives = 87/122 (71%)

Query: 8   IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
           ++ ++ KNI SG  HV +TFNNT ++ITDP GNTI+W+S   VG+SGSRK+S FAA VA 
Sbjct: 11  VKRKQLKNIPSGVVHVKATFNNTIVSITDPAGNTISWASAGKVGYSGSRKSSAFAATVAA 70

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
            D +  A N G+  +EV + G GAGR+SA+RAL A G  +  I D T + HNGCRPRKRR
Sbjct: 71  QDAAKIAMNSGLKEVEVCLKGTGAGRESAVRALIAAGLVVSVIRDETPVPHNGCRPRKRR 130

Query: 128 RI 129
           R+
Sbjct: 131 RV 132


>gi|315186308|gb|EFU20069.1| SSU ribosomal protein S11P [Spirochaeta thermophila DSM 6578]
          Length = 123

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 85/121 (70%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + +E++ +  G+ ++ +TFNNT IT+TD +GN ++W+S   +GF G++K++P+AAQV  +
Sbjct: 3   KKKEKRTVHEGKVYIQATFNNTIITVTDMNGNCVSWASAGALGFRGAKKSTPYAAQVTAE 62

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
               KA +HG+    V V G G GR++A+RA+ A+G  + S+ D+T I HNGCRPRK RR
Sbjct: 63  TAVKKAMDHGLQEAHVYVKGPGVGREAAIRAIDALGVRVRSLHDITPIPHNGCRPRKARR 122

Query: 129 I 129
           +
Sbjct: 123 V 123


>gi|300932968|ref|ZP_07148224.1| 30S ribosomal protein S11 [Corynebacterium resistens DSM 45100]
          Length = 134

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 67/132 (50%), Positives = 91/132 (68%), Gaps = 4/132 (3%)

Query: 2   PKSPSRIRNRER----KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRK 57
           PK+P+R R   R    KN+ +G A++ STFNNT ++ITDP G  I+W+S   VGF GSRK
Sbjct: 3   PKTPTRARRTGRRVVKKNVANGHAYIKSTFNNTIVSITDPKGAVISWASSGHVGFKGSRK 62

Query: 58  NSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIA 117
           ++PFAAQ+A +  + KA  HGM  ++V V G G+GR++A+R+L   G  + SI DVT   
Sbjct: 63  STPFAAQLAAESAARKAMEHGMKKVDVFVKGPGSGRETAIRSLATAGLELGSIADVTPQP 122

Query: 118 HNGCRPRKRRRI 129
           HNGCRP KRRR+
Sbjct: 123 HNGCRPPKRRRV 134


>gi|262341036|ref|YP_003283891.1| 30S ribosomal protein S11 [Blattabacterium sp. (Blattella
           germanica) str. Bge]
 gi|262272373|gb|ACY40281.1| 30S ribosomal protein S11 [Blattabacterium sp. (Blattella
           germanica) str. Bge]
          Length = 128

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 78/111 (70%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G AH+ STFNN  IT+T+  G  IAWSS   + F GS+KN+P+AAQ+A ++ + +A N G
Sbjct: 18  GEAHIQSTFNNIVITLTNKKGEVIAWSSAGKMNFKGSKKNTPYAAQMAAENVAKEAINAG 77

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +  +EVKV G GAGRD+A+RAL   G  +  I D+T + HNGCRP KRRR+
Sbjct: 78  IKKVEVKVKGPGAGRDAAIRALSNSGIVVTIIKDITPLPHNGCRPPKRRRV 128


>gi|110004253|emb|CAK98591.1| 30s ribosomal protein s11 [Spiroplasma citri]
          Length = 129

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 57/110 (51%), Positives = 79/110 (71%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G AH+ STFNNT +T++D  GN I+W+S   +GF GS+K++P+AAQ+  +     +Q HG
Sbjct: 19  GIAHIHSTFNNTIVTLSDEAGNVISWASAGAMGFKGSKKSTPYAAQMVAEAAGKASQEHG 78

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           MSS++V+V G G GRD+A+R+++ IG  I SI DVT I HNG RP KR R
Sbjct: 79  MSSVQVEVKGPGPGRDAAVRSIQTIGLEITSIKDVTPIPHNGARPPKRPR 128


>gi|94502226|ref|ZP_01308712.1| ribosomal protein S11 [Candidatus Sulcia muelleri str. Hc
           (Homalodisca coagulata)]
 gi|161833840|ref|YP_001598036.1| 30S ribosomal subunit protein S11 [Candidatus Sulcia muelleri GWSS]
 gi|172048399|sp|A8Z689|RS11_SULMW RecName: Full=30S ribosomal protein S11
 gi|94451197|gb|EAT14136.1| ribosomal protein S11 [Candidatus Sulcia muelleri str. Hc
           (Homalodisca coagulata)]
 gi|152206330|gb|ABS30640.1| 30S ribosomal subunit protein S11 [Candidatus Sulcia muelleri GWSS]
          Length = 128

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 81/122 (66%)

Query: 8   IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
            R +  +N   G AH+ ST+NN  IT+T+  G+ IAWSS   +GF GS+KN+P+AAQ+  
Sbjct: 7   FRKKNSRNYNIGEAHIKSTYNNIIITLTNKKGDVIAWSSAGKMGFKGSKKNTPYAAQITA 66

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
           +D + K  N G+  L+V V G GAGRD+A+RAL      ++ I D+T I HNGCRP K+R
Sbjct: 67  EDVAEKGLNAGIKKLKVIVKGPGAGRDAAIRALVNKNLILLVIKDITPIPHNGCRPPKKR 126

Query: 128 RI 129
           RI
Sbjct: 127 RI 128


>gi|269925857|ref|YP_003322480.1| ribosomal protein S11 [Thermobaculum terrenum ATCC BAA-798]
 gi|269789517|gb|ACZ41658.1| ribosomal protein S11 [Thermobaculum terrenum ATCC BAA-798]
          Length = 134

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 64/111 (57%), Positives = 84/111 (75%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           GRAH+VS+FNNT ITITDP GN + WSS    GF GSRK++P+AAQVA ++ + KA  +G
Sbjct: 24  GRAHIVSSFNNTIITITDPSGNVLCWSSAGASGFKGSRKSTPYAAQVAAENAARKAMEYG 83

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           M  ++V V G GAGR++A+R+L+A G  ++SI DVT I HNGCRP K RR+
Sbjct: 84  MRQVDVFVKGPGAGREAAIRSLQAAGLNVMSISDVTPIPHNGCRPPKSRRV 134


>gi|224417909|ref|ZP_03655915.1| 30S ribosomal protein S11 [Helicobacter canadensis MIT 98-5491]
 gi|242309343|ref|ZP_04808498.1| 30S ribosomal protein S11 [Helicobacter pullorum MIT 98-5489]
 gi|253827248|ref|ZP_04870133.1| 30S ribosomal protein S11 [Helicobacter canadensis MIT 98-5491]
 gi|313141450|ref|ZP_07803643.1| 30S ribosomal protein S11 [Helicobacter canadensis MIT 98-5491]
 gi|239523914|gb|EEQ63780.1| 30S ribosomal protein S11 [Helicobacter pullorum MIT 98-5489]
 gi|253510654|gb|EES89313.1| 30S ribosomal protein S11 [Helicobacter canadensis MIT 98-5491]
 gi|313130481|gb|EFR48098.1| 30S ribosomal protein S11 [Helicobacter canadensis MIT 98-5491]
          Length = 130

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 83/118 (70%), Gaps = 1/118 (0%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KNI  G  H+ + FNNT +TITD  GN I WS+   +GF GS+K++P+AAQ A +D  +
Sbjct: 13  KKNIARGIIHISAAFNNTSVTITDEMGNVICWSTAGALGFKGSKKSTPYAAQQAVEDAVS 72

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAI-GFTIVSICDVTMIAHNGCRPRKRRRI 129
           KA+ HG+  L VK+ G G+GR++A+++L +I G  ++   DVT + HNGCRP KRRR+
Sbjct: 73  KAKEHGIKELGVKIQGPGSGRETAVKSLGSIEGIKVLWFKDVTPLPHNGCRPPKRRRV 130


>gi|288919688|ref|ZP_06414015.1| ribosomal protein S11 [Frankia sp. EUN1f]
 gi|288348877|gb|EFC83127.1| ribosomal protein S11 [Frankia sp. EUN1f]
          Length = 134

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 86/115 (74%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++P+AAQ+A ++ + KA
Sbjct: 20  NVAHGHAHIKSTFNNTIVSITDPSGNVISWASAGHVGFKGSRKSTPYAAQMAAENAARKA 79

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           Q HGM  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGCRP KRRR+
Sbjct: 80  QEHGMRKVDVFVKGPGSGRETAIRSLQAAGLEVGAIQDVTPTPHNGCRPPKRRRV 134


>gi|197364266|ref|YP_002143903.1| 30S ribosomal subunit protein S11 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|207858659|ref|YP_002245310.1| 30S ribosomal subunit protein S11 [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|238758783|ref|ZP_04619957.1| 30S ribosomal protein S11 [Yersinia aldovae ATCC 35236]
 gi|238763711|ref|ZP_04624670.1| 30S ribosomal protein S11 [Yersinia kristensenii ATCC 33638]
 gi|238792958|ref|ZP_04636588.1| 30S ribosomal protein S11 [Yersinia intermedia ATCC 29909]
 gi|289824202|ref|ZP_06543797.1| 30S ribosomal protein S11 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|197095743|emb|CAR61313.1| 30S ribosomal subunit protein S11 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|206710462|emb|CAR34820.1| 30S ribosomal subunit protein S11 [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|238698013|gb|EEP90771.1| 30S ribosomal protein S11 [Yersinia kristensenii ATCC 33638]
 gi|238703080|gb|EEP95623.1| 30S ribosomal protein S11 [Yersinia aldovae ATCC 35236]
 gi|238727812|gb|EEQ19336.1| 30S ribosomal protein S11 [Yersinia intermedia ATCC 29909]
 gi|261248574|emb|CBG26412.1| 30S ribosomal subunit protein S11 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|301159960|emb|CBW19479.1| 30S ribosomal subunit protein S11 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|332086256|gb|EGI91412.1| 30S ribosomal protein S11 [Shigella dysenteriae 155-74]
          Length = 110

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 78/109 (71%)

Query: 21  AHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMS 80
           AH+ ++FNNT +TITD  GN + W++    GF GSRK++PFAAQVA + C+   + +G+ 
Sbjct: 2   AHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCADAVKEYGIK 61

Query: 81  SLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +LEV V G G GR+S +RAL A GF I +I DVT I HNGCRP K+RR+
Sbjct: 62  NLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV 110


>gi|62184757|ref|YP_219542.1| 30S ribosomal protein S11 [Chlamydophila abortus S26/3]
 gi|81313063|sp|Q5L700|RS11_CHLAB RecName: Full=30S ribosomal protein S11
 gi|62147824|emb|CAH63570.1| putative 30s ribosomal protein s11 [Chlamydophila abortus S26/3]
          Length = 132

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 67/122 (54%), Positives = 87/122 (71%)

Query: 8   IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
           ++ ++ KNI SG  HV +TFNNT ++ITDP GNTI+W+S   VG+SGSRK+S FAA VA 
Sbjct: 11  VKRKQLKNIPSGIVHVKATFNNTIVSITDPAGNTISWASAGKVGYSGSRKSSAFAATVAA 70

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
            D +  A N G+  +EV + G GAGR+SA+RAL A G  +  I D T + HNGCRPRKRR
Sbjct: 71  QDAAKIAMNSGLKEVEVCLKGTGAGRESAVRALIAAGLVVSVIRDETPVPHNGCRPRKRR 130

Query: 128 RI 129
           R+
Sbjct: 131 RV 132


>gi|150025383|ref|YP_001296209.1| 30S ribosomal protein S11 [Flavobacterium psychrophilum JIP02/86]
 gi|172048612|sp|A6GZ75|RS11_FLAPJ RecName: Full=30S ribosomal protein S11
 gi|149771924|emb|CAL43398.1| 30S ribosomal protein S11 [Flavobacterium psychrophilum JIP02/86]
          Length = 127

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 59/121 (48%), Positives = 82/121 (67%), Gaps = 2/121 (1%)

Query: 11  RERKNIVS--GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           ++RK IV   G AH+ +TFNN  I++T+  G  ++WSS   +GF GS+KN+P+AAQ+A +
Sbjct: 7   KKRKVIVESIGEAHISATFNNIIISLTNKKGEVVSWSSAGKMGFRGSKKNTPYAAQMAAE 66

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           DCS  A   GM  ++V V G G GR+SA+R+L   G  +  I DVT + HNGCRP KRRR
Sbjct: 67  DCSKVAMEAGMKKVKVYVKGPGNGRESAIRSLHNAGIEVTEIIDVTPLPHNGCRPPKRRR 126

Query: 129 I 129
           +
Sbjct: 127 V 127


>gi|295425628|ref|ZP_06818315.1| 30S ribosomal protein S11 [Lactobacillus amylolyticus DSM 11664]
 gi|295064644|gb|EFG55565.1| 30S ribosomal protein S11 [Lactobacillus amylolyticus DSM 11664]
          Length = 127

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 90/129 (69%), Gaps = 2/129 (1%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           MPK+  +   R +K++ SG AH+ STFNNT + ITD  GN IAWSS   +GF GSRK++P
Sbjct: 1   MPKTARK--RRVKKHVESGVAHIQSTFNNTLVMITDVQGNAIAWSSAGALGFKGSRKSTP 58

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  +  A + GM  +EV V G GAGR+SA+R+L+A G  I +I DVT + HNG
Sbjct: 59  FAAQMAAEAAAKSAMDQGMKRVEVSVKGPGAGRESAIRSLQATGLEITAIRDVTPVPHNG 118

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 119 SRPPKRRRV 127


>gi|283794917|ref|YP_003359270.1| ribosomal protein S11 [Cryptomonas paramecium]
 gi|253981889|gb|ACT46806.1| ribosomal protein S11 [Cryptomonas paramecium]
          Length = 130

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 63/119 (52%), Positives = 82/119 (68%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           R++K    G AHV STFNNT ITIT+  G+TIAWSS   VGF G++K++PF AQVA ++ 
Sbjct: 12  RDKKVHPKGVAHVQSTFNNTIITITNLLGDTIAWSSAGSVGFKGAKKSTPFGAQVAAENA 71

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +    + G+  +EV V G GAGR++A+RAL+  G  I  I DVT   HNGCRP K+RRI
Sbjct: 72  AKSVISKGLKEIEVFVDGPGAGREAAIRALKTTGLEIKLIHDVTSTPHNGCRPPKKRRI 130


>gi|332181993|gb|AEE17681.1| 30S ribosomal protein S11 [Treponema brennaborense DSM 12168]
          Length = 126

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 84/121 (69%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + +E+K++  G  ++ +TFNNT +TITD  GN ++W+S   +GF G++K++PFAAQ   +
Sbjct: 6   KRKEKKSVYEGNVYIQATFNNTIVTITDLKGNALSWASSGGLGFRGAKKSTPFAAQSVAE 65

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
               KA ++G+  + V V G G GR+SA+R+L A+G  + SI DVT I HNGCRPRK RR
Sbjct: 66  TAVQKAASYGLREVHVFVKGPGVGRESAVRSLGALGLKVKSISDVTPIPHNGCRPRKTRR 125

Query: 129 I 129
           +
Sbjct: 126 M 126


>gi|302877825|ref|YP_003846389.1| 30S ribosomal protein S11 [Gallionella capsiferriformans ES-2]
 gi|302580614|gb|ADL54625.1| 30S ribosomal protein S11 [Gallionella capsiferriformans ES-2]
          Length = 129

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 78/111 (70%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G AHV ++FNNT +TITD  GN +AWS+    GF GSRK++PFAAQVA +     A   G
Sbjct: 19  GIAHVHASFNNTIVTITDRQGNALAWSTSGANGFKGSRKSTPFAAQVAAEVVGKSAAECG 78

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + ++EV++ G G GR+S +RAL A GF I SI D+T + HNGCRP K+RRI
Sbjct: 79  VKNIEVRIKGPGPGRESTVRALNAAGFKITSISDITPVPHNGCRPPKKRRI 129


>gi|309812368|ref|ZP_07706123.1| 30S ribosomal protein S11 [Dermacoccus sp. Ellin185]
 gi|308433673|gb|EFP57550.1| 30S ribosomal protein S11 [Dermacoccus sp. Ellin185]
          Length = 135

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 61/123 (49%), Positives = 91/123 (73%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +E+KN+ +G+AH+ STFNNT ++ITDP G  I+W+S   VGF GSRK++P+AAQ+A
Sbjct: 13  KVRRKEKKNVAAGQAHIKSTFNNTIVSITDPTGAVISWASAGQVGFKGSRKSTPYAAQMA 72

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +A +HGM  ++V V G G+GR++A+R+L A G  + +I DVT   HNG RP KR
Sbjct: 73  AEAAARRAMDHGMRKVDVFVKGPGSGRETAIRSLTATGLEVGAISDVTPTPHNGVRPPKR 132

Query: 127 RRI 129
           RR+
Sbjct: 133 RRV 135


>gi|227879267|ref|ZP_03997137.1| ribosomal protein S11 [Lactobacillus crispatus JV-V01]
 gi|227894545|ref|ZP_04012350.1| ribosomal protein S11 [Lactobacillus ultunensis DSM 16047]
 gi|256844454|ref|ZP_05549940.1| 30S ribosomal protein S11 [Lactobacillus crispatus 125-2-CHN]
 gi|256849158|ref|ZP_05554591.1| 30S ribosomal protein S11 [Lactobacillus crispatus MV-1A-US]
 gi|260102380|ref|ZP_05752617.1| 30S ribosomal protein S11 [Lactobacillus helveticus DSM 20075]
 gi|262047174|ref|ZP_06020132.1| 30S ribosomal protein S11 [Lactobacillus crispatus MV-3A-US]
 gi|293380401|ref|ZP_06626472.1| 30S ribosomal protein S11 [Lactobacillus crispatus 214-1]
 gi|295692184|ref|YP_003600794.1| 30S ribosomal protein s11 [Lactobacillus crispatus ST1]
 gi|315037555|ref|YP_004031123.1| 30S ribosomal protein S11 [Lactobacillus amylovorus GRL 1112]
 gi|325956028|ref|YP_004286638.1| 30S ribosomal protein S11 [Lactobacillus acidophilus 30SC]
 gi|227861161|gb|EEJ68810.1| ribosomal protein S11 [Lactobacillus crispatus JV-V01]
 gi|227863704|gb|EEJ71125.1| ribosomal protein S11 [Lactobacillus ultunensis DSM 16047]
 gi|256613532|gb|EEU18735.1| 30S ribosomal protein S11 [Lactobacillus crispatus 125-2-CHN]
 gi|256713934|gb|EEU28922.1| 30S ribosomal protein S11 [Lactobacillus crispatus MV-1A-US]
 gi|260083824|gb|EEW67944.1| 30S ribosomal protein S11 [Lactobacillus helveticus DSM 20075]
 gi|260572419|gb|EEX28981.1| 30S ribosomal protein S11 [Lactobacillus crispatus MV-3A-US]
 gi|290923084|gb|EFE00016.1| 30S ribosomal protein S11 [Lactobacillus crispatus 214-1]
 gi|295030290|emb|CBL49769.1| 30S ribosomal protein S11 [Lactobacillus crispatus ST1]
 gi|312275688|gb|ADQ58328.1| 30S ribosomal protein S11 [Lactobacillus amylovorus GRL 1112]
 gi|325332593|gb|ADZ06501.1| 30S ribosomal protein S11 [Lactobacillus acidophilus 30SC]
 gi|327182851|gb|AEA31298.1| 30S ribosomal protein S11 [Lactobacillus amylovorus GRL 1118]
 gi|328463389|gb|EGF35062.1| 30S ribosomal protein S11 [Lactobacillus helveticus MTCC 5463]
          Length = 129

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           MP   +  + R +K++ SG AH+ STFNNT + ITD  GN +AWSS   +GF GSRK++P
Sbjct: 1   MPAKKTARKRRVKKHVESGVAHIHSTFNNTLVMITDVQGNAVAWSSAGALGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  +  A + GM  +EV V G GAGR+SA+R+L+A G  I +I DVT + HNG
Sbjct: 61  FAAQMAAEAAAKSAMDQGMKHVEVSVKGPGAGRESAIRSLQATGLEITAIRDVTPVPHNG 120

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 121 SRPPKRRRV 129


>gi|168334325|ref|ZP_02692512.1| 30S ribosomal protein S11 [Epulopiscium sp. 'N.t. morphotype B']
          Length = 135

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R R+RKN+  G AH+ STFNNT +T+TD +GN ++W+S   +GF GSRK++P+AAQ+A +
Sbjct: 15  RRRDRKNVEKGMAHIQSTFNNTMVTLTDANGNALSWASAGGLGFRGSRKSTPYAAQMAAE 74

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +A A  +G+  +EV V G G+GR++A+RAL+A G  +  I DVT + HNGCRP KRRR
Sbjct: 75  TAAAAAMEYGLKQVEVMVKGPGSGREAAIRALQAAGLEVTLIKDVTPVPHNGCRPPKRRR 134

Query: 129 I 129
           +
Sbjct: 135 V 135


>gi|254458631|ref|ZP_05072055.1| ribosomal protein S11 [Campylobacterales bacterium GD 1]
 gi|207084397|gb|EDZ61685.1| ribosomal protein S11 [Campylobacterales bacterium GD 1]
          Length = 130

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 81/116 (69%), Gaps = 1/116 (0%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI  G  H+ ++FNNT +TITD  GN IAWSS   +GF GS+K++PFAAQ A +D  AKA
Sbjct: 15  NIARGICHISASFNNTLVTITDEMGNMIAWSSAGSLGFKGSKKSTPFAAQAAVEDAVAKA 74

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAI-GFTIVSICDVTMIAHNGCRPRKRRRI 129
           Q HG+  L +KV G G+GR++A +A+ AI G  +  + DVT + HNGCR  KRRR+
Sbjct: 75  QVHGIKELGIKVQGPGSGRETATKAVGAIEGIRVTFMKDVTALPHNGCRAPKRRRV 130


>gi|71065082|ref|YP_263809.1| 30S ribosomal protein S11 [Psychrobacter arcticus 273-4]
 gi|93005337|ref|YP_579774.1| 30S ribosomal protein S11 [Psychrobacter cryohalolentis K5]
 gi|91207673|sp|Q4FUD3|RS11_PSYA2 RecName: Full=30S ribosomal protein S11
 gi|123083420|sp|Q1QDG3|RS11_PSYCK RecName: Full=30S ribosomal protein S11
 gi|71038067|gb|AAZ18375.1| SSU ribosomal protein S11P [Psychrobacter arcticus 273-4]
 gi|92393015|gb|ABE74290.1| SSU ribosomal protein S11P [Psychrobacter cryohalolentis K5]
          Length = 129

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 84/117 (71%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           R+++  G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++PFAAQVA +    
Sbjct: 13  RRSVSEGIAHIHASFNNTIVTITDRQGNALAWATSGGQGFRGSRKSTPFAAQVAAEVAGK 72

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            AQ +G+ +++V V G G GR+SA+RAL A+G+ + SI DVT I HNGCR  K+RR+
Sbjct: 73  AAQEYGVKNIDVLVKGPGPGRESAVRALGALGYKVNSISDVTPIPHNGCRAPKKRRV 129


>gi|300812378|ref|ZP_07092813.1| 30S ribosomal protein S11 [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
 gi|313123134|ref|YP_004033393.1| 30S ribosomal protein s11 [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|300496683|gb|EFK31770.1| 30S ribosomal protein S11 [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
 gi|312279697|gb|ADQ60416.1| 30S ribosomal protein S11 [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|325684744|gb|EGD26898.1| 30S ribosomal protein S11 [Lactobacillus delbrueckii subsp. lactis
           DSM 20072]
          Length = 129

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           MP   +  + R +K++ SG AH+ STFNNT + ITD  GN +AWSS   +GF GSRK++P
Sbjct: 1   MPAKKTARKRRVKKHVESGVAHIHSTFNNTLVMITDVQGNAVAWSSAGALGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  +  A + GM  +EV V G G+GR+SA+RAL+A G  I SI DVT + HNG
Sbjct: 61  FAAQMAAEAAAKSAIDQGMKHIEVSVKGPGSGRESAIRALQAAGLEITSIRDVTPVPHNG 120

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 121 SRPPKRRRV 129


>gi|161506897|ref|YP_001576851.1| 30S ribosomal protein S11 [Lactobacillus helveticus DPC 4571]
 gi|172048387|sp|A8YXM9|RS11_LACH4 RecName: Full=30S ribosomal protein S11
 gi|160347886|gb|ABX26560.1| 30S ribosomal protein S11 [Lactobacillus helveticus DPC 4571]
 gi|323465847|gb|ADX69534.1| 30S ribosomal protein S11 [Lactobacillus helveticus H10]
          Length = 130

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           MP   +  + R +K++ SG AH+ STFNNT + ITD  GN +AWSS   +GF GSRK++P
Sbjct: 2   MPAKKTARKRRVKKHVESGVAHIHSTFNNTLVMITDVQGNAVAWSSAGALGFKGSRKSTP 61

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  +  A + GM  +EV V G GAGR+SA+R+L+A G  I +I DVT + HNG
Sbjct: 62  FAAQMAAEAAAKSAMDQGMKHVEVSVKGPGAGRESAIRSLQATGLEITAIRDVTPVPHNG 121

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 122 SRPPKRRRV 130


>gi|312199994|ref|YP_004020055.1| 30S ribosomal protein S11 [Frankia sp. EuI1c]
 gi|311231330|gb|ADP84185.1| 30S ribosomal protein S11 [Frankia sp. EuI1c]
          Length = 135

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 86/115 (74%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G AH+ STFNNT ++ITDP GN I+W+S   VGF GSRK++P+AAQ+A ++ + KA
Sbjct: 21  NVAHGHAHIKSTFNNTIVSITDPTGNVISWASAGHVGFKGSRKSTPYAAQMAAENAARKA 80

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           Q HGM  ++V V G G+GR++A+R+L+A G  + +I DVT   HNGCRP KRRR+
Sbjct: 81  QEHGMRKVDVFVKGPGSGRETAIRSLQAAGLEVGTIQDVTPTPHNGCRPPKRRRV 135


>gi|313903125|ref|ZP_07836519.1| SSU ribosomal protein S11P [Thermaerobacter subterraneus DSM 13965]
 gi|313466627|gb|EFR62147.1| SSU ribosomal protein S11P [Thermaerobacter subterraneus DSM 13965]
          Length = 140

 Score =  123 bits (309), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 89/124 (71%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R+R ++RKN+  G AH+ STFNNT +TITD  GN IA+ S    GF+GS+K +P+AAQ+
Sbjct: 17  TRLRRKDRKNVERGIAHIRSTFNNTIVTITDLQGNAIAFGSGGTNGFTGSKKGTPYAAQL 76

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  + +A  HGM  +EV V G G GR++A+R+L+A G  + +I DVT I HNGCRP K
Sbjct: 77  AAEQAAREAMEHGMREVEVWVKGPGPGREAAIRSLQATGLEVTAIKDVTPIPHNGCRPPK 136

Query: 126 RRRI 129
           RRR+
Sbjct: 137 RRRV 140


>gi|227487076|ref|ZP_03917392.1| ribosomal protein S11 [Corynebacterium glucuronolyticum ATCC 51867]
 gi|227541760|ref|ZP_03971809.1| ribosomal protein S11 [Corynebacterium glucuronolyticum ATCC 51866]
 gi|227093150|gb|EEI28462.1| ribosomal protein S11 [Corynebacterium glucuronolyticum ATCC 51867]
 gi|227182466|gb|EEI63438.1| ribosomal protein S11 [Corynebacterium glucuronolyticum ATCC 51866]
          Length = 133

 Score =  123 bits (309), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 61/118 (51%), Positives = 88/118 (74%)

Query: 12  ERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCS 71
           ++KN+  G A++ STFNNT ++ITDP G  I+W+S   VGF GSRK++PFAAQ+A ++ +
Sbjct: 16  QKKNVAQGHAYIKSTFNNTIVSITDPSGAVISWASSGHVGFKGSRKSTPFAAQMAAENAA 75

Query: 72  AKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            KA +HGM  ++V V G G+GR++A+R+L+A G  + S+ DVT   HNGCRP KRRR+
Sbjct: 76  RKAMDHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVTSMSDVTPQPHNGCRPPKRRRV 133


>gi|227903212|ref|ZP_04021017.1| ribosomal protein S11 [Lactobacillus acidophilus ATCC 4796]
 gi|227869017|gb|EEJ76438.1| ribosomal protein S11 [Lactobacillus acidophilus ATCC 4796]
          Length = 129

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           MP   +  + R +K++ SG AH+ STFNNT + ITD  GN +AWSS   +GF GSRK++P
Sbjct: 1   MPAKKTARKRRVKKHVESGVAHIHSTFNNTLVMITDVQGNAVAWSSAGALGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  +  A + GM  +EV V G GAGR+SA+R+L+A G  I +I DVT + HNG
Sbjct: 61  FAAQMAAEAAAKSAMDQGMKRVEVSVKGPGAGRESAIRSLQATGLEITAIRDVTPVPHNG 120

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 121 SRPPKRRRV 129


>gi|86609044|ref|YP_477806.1| 30S ribosomal protein S11 [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|123737996|sp|Q2JL75|RS11_SYNJB RecName: Full=30S ribosomal protein S11
 gi|86557586|gb|ABD02543.1| ribosomal protein S11 [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 128

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 87/117 (74%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KNI +G A++ STFNNT +TITDP+G+ ++W+S    GF G++K +PFAAQ+A +  + 
Sbjct: 12  KKNIPNGVAYIQSTFNNTIVTITDPNGDVVSWASAGSTGFKGAKKGTPFAAQMAAESAAR 71

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +A  +GM  +EV VSG GAGR++A+RAL+A G  I  I D+T I HNGCRP KRRR+
Sbjct: 72  QAMENGMRQIEVMVSGPGAGRETAIRALQATGLEITLIRDITPIPHNGCRPPKRRRV 128


>gi|30468202|ref|NP_849089.1| ribosomal protein S11 [Cyanidioschyzon merolae strain 10D]
 gi|62287466|sp|Q85FU4|RR11_CYAME RecName: Full=30S ribosomal protein S11, chloroplastic
 gi|30409302|dbj|BAC76251.1| 30S ribosomal protein S11 [Cyanidioschyzon merolae strain 10D]
          Length = 121

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 77/111 (69%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G  H+ STFNNT IT++D  G  + WSS  +VGF G++K +PFAA +A +  +  A++ G
Sbjct: 11  GSIHIQSTFNNTLITVSDAQGACVCWSSAGLVGFKGAKKGTPFAAGMAAEKVAQLAKDQG 70

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           M  ++V V G GAGR++A+RAL A G  I SI DVT I HNGCRP KRRR+
Sbjct: 71  MKQVDVFVKGPGAGRETAIRALEAAGLQITSIQDVTGIPHNGCRPPKRRRV 121


>gi|238922855|ref|YP_002936368.1| 30S ribosomal protein S11 [Eubacterium rectale ATCC 33656]
 gi|238874527|gb|ACR74234.1| 30S ribosomal protein S11 [Eubacterium rectale ATCC 33656]
 gi|291523755|emb|CBK89342.1| SSU ribosomal protein S11P [Eubacterium rectale DSM 17629]
 gi|291528779|emb|CBK94365.1| SSU ribosomal protein S11P [Eubacterium rectale M104/1]
          Length = 131

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 55/115 (47%), Positives = 84/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G+AH+ ++FNNT +T+TD  GN ++W+S   +GF GS+K++P+AAQ+A +  +  A
Sbjct: 17  NVERGQAHIQASFNNTIVTLTDAEGNALSWASAGGLGFRGSKKSTPYAAQMAAETATKAA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ +++V V G G+GR++A+RAL A G  + SI DVT + HNGCRP KRRR+
Sbjct: 77  LIHGLKTVDVFVKGPGSGREAAIRALSACGLEVTSIRDVTPVPHNGCRPPKRRRV 131


>gi|213964788|ref|ZP_03392987.1| 30S ribosomal protein S11 [Corynebacterium amycolatum SK46]
 gi|213952324|gb|EEB63707.1| 30S ribosomal protein S11 [Corynebacterium amycolatum SK46]
          Length = 134

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 87/117 (74%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KN+  G A++ STFNNT ++ITDP G  I+W+S   VGF GSRK++PFAAQ+A ++ + 
Sbjct: 18  KKNVAQGHAYIKSTFNNTIVSITDPKGAVISWASSGHVGFKGSRKSTPFAAQMAAENAAR 77

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           KA +HGM  ++V V G G+GR++A+R+L+A G  + SI DVT   HNGCRP KRRR+
Sbjct: 78  KAMDHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVSSISDVTPQPHNGCRPPKRRRV 134


>gi|317054793|ref|YP_004103260.1| 30S ribosomal protein S11 [Ruminococcus albus 7]
 gi|325678666|ref|ZP_08158276.1| 30S ribosomal protein S11 [Ruminococcus albus 8]
 gi|315447062|gb|ADU20626.1| 30S ribosomal protein S11 [Ruminococcus albus 7]
 gi|324109716|gb|EGC03922.1| 30S ribosomal protein S11 [Ruminococcus albus 8]
          Length = 132

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 86/121 (71%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R RERKNI  G+ H+ STFNNT +TITD  GN I+W+S   +GF GS+K++PFAAQ A +
Sbjct: 12  RRRERKNIEQGQVHIQSTFNNTIVTITDMQGNAISWASAGGLGFRGSKKSTPFAAQTAAE 71

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A+ HG+  +EV V G GAGR++A+RAL++    +  I DVT I HNGCRP KRRR
Sbjct: 72  TAARAAKEHGLKVVEVFVKGPGAGREAAIRALQSEELEVRLIKDVTPIPHNGCRPPKRRR 131

Query: 129 I 129
           +
Sbjct: 132 V 132


>gi|257456915|ref|ZP_05622096.1| 30S ribosomal protein S11 [Treponema vincentii ATCC 35580]
 gi|257445624|gb|EEV20686.1| 30S ribosomal protein S11 [Treponema vincentii ATCC 35580]
          Length = 127

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 82/121 (67%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + +E+K++  G  ++ +TFNNT ITITD  GN ++W+S   +GF+G++K++PFAAQ   +
Sbjct: 7   KRKEKKSVYEGNVYIQATFNNTIITITDLKGNALSWASSGGLGFNGAKKSTPFAAQTVAE 66

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
               + Q +G+  + V V G G GR+SA+R L  +G  + SI DVT I HNGCRPRK RR
Sbjct: 67  TAVQRVQQYGLREVHVFVKGPGVGRESAIRTLGVMGLKVRSINDVTPIPHNGCRPRKTRR 126

Query: 129 I 129
           I
Sbjct: 127 I 127


>gi|25027126|ref|NP_737180.1| 30S ribosomal protein S11 [Corynebacterium efficiens YS-314]
 gi|33302578|sp|P59371|RS11_COREF RecName: Full=30S ribosomal protein S11
 gi|23492406|dbj|BAC17380.1| putative 30S ribosomal protein S11 [Corynebacterium efficiens
           YS-314]
          Length = 134

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 88/117 (75%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KN+  G A++ STFNNT ++ITDP+G  I+W+S   VGF GSRK++PFAAQ+A ++ + 
Sbjct: 18  KKNVAQGHAYIKSTFNNTIVSITDPNGAVISWASSGHVGFKGSRKSTPFAAQMAAENAAR 77

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           KA +HGM  ++V V G G+GR++A+R+L+A G  + SI DVT   HNGCRP KRRR+
Sbjct: 78  KAMDHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVSSISDVTPQPHNGCRPPKRRRV 134


>gi|154483163|ref|ZP_02025611.1| hypothetical protein EUBVEN_00864 [Eubacterium ventriosum ATCC
           27560]
 gi|149735971|gb|EDM51857.1| hypothetical protein EUBVEN_00864 [Eubacterium ventriosum ATCC
           27560]
          Length = 131

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 83/115 (72%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G+AH+ ++FNNT +T+TD  GN ++W+S   +GF GS+K++P+AAQ+A +  +  A
Sbjct: 17  NVEHGQAHIQASFNNTIVTLTDAEGNALSWASAGGLGFRGSKKSTPYAAQMAAETATKAA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ +++V V G G+GR++A+RAL   G  + SI DVT + HNGCRP KRRR+
Sbjct: 77  LVHGLKTVDVMVKGPGSGREAAIRALATCGLEVTSIKDVTPVPHNGCRPPKRRRV 131


>gi|297623300|ref|YP_003704734.1| 30S ribosomal protein S11 [Truepera radiovictrix DSM 17093]
 gi|297164480|gb|ADI14191.1| 30S ribosomal protein S11 [Truepera radiovictrix DSM 17093]
          Length = 131

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 93/126 (73%)

Query: 4   SPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAA 63
           + ++ + R R+N+V G+A++ +++NNT +TITD  GN +AWSS   +G+ GS+K +P+AA
Sbjct: 6   AKNKTKKRVRRNLVEGKAYIHASYNNTIVTITDMDGNAVAWSSSGSIGYKGSKKGTPYAA 65

Query: 64  QVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRP 123
           Q+A  D + KAQN G++ L++ + G G+GR+ A+R+++A G  + SI D T + HNGCRP
Sbjct: 66  QLAAADATRKAQNMGVTQLDIVIRGTGSGREQAIRSIQATGVNVRSIVDATPVPHNGCRP 125

Query: 124 RKRRRI 129
           RKR+R+
Sbjct: 126 RKRKRV 131


>gi|148652260|ref|YP_001279353.1| 30S ribosomal protein S11 [Psychrobacter sp. PRwf-1]
 gi|172048489|sp|A5WCL2|RS11_PSYWF RecName: Full=30S ribosomal protein S11
 gi|148571344|gb|ABQ93403.1| SSU ribosomal protein S11P [Psychrobacter sp. PRwf-1]
          Length = 130

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 61/118 (51%), Positives = 85/118 (72%), Gaps = 1/118 (0%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           R+++  G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++PFAAQVA +    
Sbjct: 13  RRSVSEGVAHIHASFNNTIVTITDRQGNALAWATSGGQGFRGSRKSTPFAAQVAAEVAGK 72

Query: 73  KAQN-HGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            AQ  +G+ +++V V G G GR+SA+RAL A+G+ I SI DVT I HNGCRP K+RR+
Sbjct: 73  AAQETYGVKNVDVLVKGPGPGRESAVRALGALGYKINSISDVTPIPHNGCRPPKKRRV 130


>gi|119946250|ref|YP_943930.1| 30S ribosomal protein S11 [Psychromonas ingrahamii 37]
 gi|119947103|ref|YP_944783.1| 30S ribosomal protein S11 [Psychromonas ingrahamii 37]
 gi|152060811|sp|A1SXW6|RS11_PSYIN RecName: Full=30S ribosomal protein S11
 gi|119864854|gb|ABM04331.1| SSU ribosomal protein S11P [Psychromonas ingrahamii 37]
 gi|119865707|gb|ABM05184.1| SSU ribosomal protein S11P [Psychromonas ingrahamii 37]
          Length = 129

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 63/129 (48%), Positives = 93/129 (72%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P+R R R +K +  G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKTPTRARKRVKKQVADGMAHIHASFNNTIVTITDRQGNALSWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  +  A+ +G+ ++EV V+G G GR+S++RAL A GF + +I DVT I HNG
Sbjct: 61  FAAQIAAERAAEAAKEYGLKNVEVFVNGPGPGRESSIRALNAAGFRVTNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|307543848|ref|YP_003896327.1| 30S ribosomal protein S11 [Halomonas elongata DSM 2581]
 gi|307215872|emb|CBV41142.1| 30S ribosomal protein S11 [Halomonas elongata DSM 2581]
          Length = 128

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 87/126 (69%)

Query: 4   SPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAA 63
           +P   R + +K +V   AH+ ++FNNT ITITD  GN ++W++    GF GSRK++PFAA
Sbjct: 3   NPRSNRKKVKKQVVDAVAHIHASFNNTIITITDRQGNALSWATAGGSGFRGSRKSTPFAA 62

Query: 64  QVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRP 123
           QVA++  +  A  +G+ +++V V G G GR+SA+RAL A GF + SI D T I HNGCRP
Sbjct: 63  QVASERAATAAAEYGVKNVDVLVKGPGPGRESAVRALNAAGFRVQSITDATPIPHNGCRP 122

Query: 124 RKRRRI 129
            K+RR+
Sbjct: 123 PKKRRV 128


>gi|239918174|ref|YP_002957732.1| SSU ribosomal protein S11P [Micrococcus luteus NCTC 2665]
 gi|281415636|ref|ZP_06247378.1| SSU ribosomal protein S11P [Micrococcus luteus NCTC 2665]
 gi|289706558|ref|ZP_06502908.1| 30S ribosomal protein S11 [Micrococcus luteus SK58]
 gi|259494629|sp|C5CC37|RS11_MICLC RecName: Full=30S ribosomal protein S11
 gi|239839381|gb|ACS31178.1| SSU ribosomal protein S11P [Micrococcus luteus NCTC 2665]
 gi|289556693|gb|EFD50034.1| 30S ribosomal protein S11 [Micrococcus luteus SK58]
          Length = 134

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 88/121 (72%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +  KNI  G+AH+ STFNNT ++ITD  G  I+W+S   VGF GSRK++P+AAQ+A +
Sbjct: 14  RRKANKNITVGQAHIKSTFNNTIVSITDTTGAVISWASSGEVGFKGSRKSTPYAAQMAAE 73

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + +AQ HGM  ++V V G G+GR++A+R+L+A G  + SI DVT +AHNG RP KRRR
Sbjct: 74  QAAKRAQEHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVGSIQDVTPMAHNGARPAKRRR 133

Query: 129 I 129
           +
Sbjct: 134 V 134


>gi|237747388|ref|ZP_04577868.1| small subunit ribosomal protein S11 [Oxalobacter formigenes HOxBLS]
 gi|229378739|gb|EEO28830.1| small subunit ribosomal protein S11 [Oxalobacter formigenes HOxBLS]
          Length = 133

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 86/124 (69%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R+R + ++NI  G AHV ++FNNT ITITD  GN + W++    GF GSRK++PFAAQV
Sbjct: 10  ARVRKKVKRNIAEGVAHVHASFNNTIITITDRQGNALTWATSGGAGFKGSRKSTPFAAQV 69

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +     A  +G+ +LEVK+ G G GR+SA+RAL  +G  I  I D+T I HNGCRP K
Sbjct: 70  AAEAAGKVAIEYGIKNLEVKIKGPGPGRESAVRALNGLGIRITQIQDITPIPHNGCRPPK 129

Query: 126 RRRI 129
           RRRI
Sbjct: 130 RRRI 133


>gi|227485500|ref|ZP_03915816.1| ribosomal protein S11 [Anaerococcus lactolyticus ATCC 51172]
 gi|227236499|gb|EEI86514.1| ribosomal protein S11 [Anaerococcus lactolyticus ATCC 51172]
          Length = 132

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 89/127 (70%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K  ++ R R +KN+  G+AH+ STFNNT +T+TD  GN ++W+S   +GF GSRK++PFA
Sbjct: 6   KKSTKGRRRVKKNVERGQAHISSTFNNTMVTLTDMQGNALSWASAGQLGFRGSRKSTPFA 65

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           A  A +  +  A + G+ ++EV V G G+GR++A+R+L+A G  +  I DVT I HNGCR
Sbjct: 66  AGEAAETAAKIAIDQGLKTVEVYVKGPGSGREAAIRSLQAAGLEVTMIKDVTPIPHNGCR 125

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 126 PPKRRRV 132


>gi|296113775|ref|YP_003627713.1| 30S ribosomal protein S11 [Moraxella catarrhalis RH4]
 gi|295921469|gb|ADG61820.1| 30S ribosomal protein S11 [Moraxella catarrhalis RH4]
 gi|326562120|gb|EGE12448.1| 30S ribosomal protein S11 [Moraxella catarrhalis 7169]
 gi|326564515|gb|EGE14741.1| 30S ribosomal protein S11 [Moraxella catarrhalis 46P47B1]
 gi|326565698|gb|EGE15861.1| 30S ribosomal protein S11 [Moraxella catarrhalis 12P80B1]
 gi|326566267|gb|EGE16419.1| 30S ribosomal protein S11 [Moraxella catarrhalis 103P14B1]
 gi|326567081|gb|EGE17203.1| 30S ribosomal protein S11 [Moraxella catarrhalis BC1]
 gi|326568345|gb|EGE18425.1| 30S ribosomal protein S11 [Moraxella catarrhalis BC7]
 gi|326572246|gb|EGE22241.1| 30S ribosomal protein S11 [Moraxella catarrhalis BC8]
 gi|326574588|gb|EGE24528.1| 30S ribosomal protein S11 [Moraxella catarrhalis O35E]
 gi|326574844|gb|EGE24774.1| 30S ribosomal protein S11 [Moraxella catarrhalis 101P30B1]
 gi|326576168|gb|EGE26083.1| 30S ribosomal protein S11 [Moraxella catarrhalis CO72]
          Length = 130

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 61/118 (51%), Positives = 85/118 (72%), Gaps = 1/118 (0%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           R+++  G AH+ ++FNNT +TITD  GN +AW++    GF GSRK++PFAAQVA +    
Sbjct: 13  RRSVSEGIAHIHASFNNTIVTITDRQGNALAWATSGGQGFRGSRKSTPFAAQVAAEVAGK 72

Query: 73  KAQN-HGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            AQ  +G+ +++V V G G GR+SA+RAL A+G+ I SI DVT I HNGCRP K+RR+
Sbjct: 73  TAQETYGVKNVDVLVKGPGPGRESAVRALGALGYKINSISDVTPIPHNGCRPPKKRRV 130


>gi|229821594|ref|YP_002883120.1| ribosomal protein S11 [Beutenbergia cavernae DSM 12333]
 gi|259494615|sp|C5C0G2|RS11_BEUC1 RecName: Full=30S ribosomal protein S11
 gi|229567507|gb|ACQ81358.1| ribosomal protein S11 [Beutenbergia cavernae DSM 12333]
          Length = 135

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 90/123 (73%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           + R +E+KN+  G A++ STFNNT ++ITDP G  IAW+S   VGF GSRK++PFAAQ+A
Sbjct: 13  KTRRKEKKNVSHGHAYIKSTFNNTIVSITDPSGAVIAWASSGQVGFKGSRKSTPFAAQLA 72

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +AQ HGM  ++V V G G+GR++A+R+L+A G  + SI DVT  AHNG RP KR
Sbjct: 73  AEAAARRAQEHGMKKVDVFVKGPGSGRETAIRSLQATGLEVGSISDVTPQAHNGVRPPKR 132

Query: 127 RRI 129
           RR+
Sbjct: 133 RRV 135


>gi|15639204|ref|NP_218651.1| 30S ribosomal protein S11 [Treponema pallidum subsp. pallidum str.
           Nichols]
 gi|189025445|ref|YP_001933217.1| 30S ribosomal protein S11 [Treponema pallidum subsp. pallidum SS14]
 gi|6094149|sp|O83241|RS11_TREPA RecName: Full=30S ribosomal protein S11
 gi|226708430|sp|B2S2F9|RS11_TREPS RecName: Full=30S ribosomal protein S11
 gi|3322480|gb|AAC65200.1| ribosomal protein S11 (rpsK) [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189018020|gb|ACD70638.1| ribosomal protein S11 [Treponema pallidum subsp. pallidum SS14]
 gi|291059616|gb|ADD72351.1| 30S ribosomal protein S11 [Treponema pallidum subsp. pallidum str.
           Chicago]
          Length = 126

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 82/121 (67%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + +E+KN+  G  ++ +TFNNT IT+TD  GN ++W+S   +GF+G++K++PFAAQ   +
Sbjct: 6   KRKEKKNVYEGNVYIQATFNNTIITVTDLQGNALSWASSGGLGFNGAKKSTPFAAQTVAE 65

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
               KAQ  G+  + V V G G GR+SA+R L  +G  + SI D+T I HNGCRPRK RR
Sbjct: 66  AAVQKAQQCGLREVHVFVKGPGIGRESAIRMLGTMGLRVRSIRDITPIPHNGCRPRKTRR 125

Query: 129 I 129
           I
Sbjct: 126 I 126


>gi|282898335|ref|ZP_06306326.1| Ribosomal protein S11 [Raphidiopsis brookii D9]
 gi|282899974|ref|ZP_06307935.1| Ribosomal protein S11 [Cylindrospermopsis raciborskii CS-505]
 gi|281195244|gb|EFA70180.1| Ribosomal protein S11 [Cylindrospermopsis raciborskii CS-505]
 gi|281196866|gb|EFA71771.1| Ribosomal protein S11 [Raphidiopsis brookii D9]
          Length = 131

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 81/115 (70%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+ +G A++ STFNN+ +TITD +G+ I+W+S    GF G++K +PFAAQ A +    +A
Sbjct: 17  NVPNGVAYIQSTFNNSIVTITDQNGDVISWASAGSSGFKGAKKGTPFAAQTAAESAGRRA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            + GM  ++V VSG GAGR++A+RAL+  G  I  I DVT I HNGCRP KRRR+
Sbjct: 77  IDQGMRQIQVMVSGPGAGRETAIRALQGAGLEITLIRDVTPIPHNGCRPPKRRRV 131


>gi|86606120|ref|YP_474883.1| 30S ribosomal protein S11 [Synechococcus sp. JA-3-3Ab]
 gi|123738107|sp|Q2JUJ4|RS11_SYNJA RecName: Full=30S ribosomal protein S11
 gi|86554662|gb|ABC99620.1| ribosomal protein S11 [Synechococcus sp. JA-3-3Ab]
          Length = 128

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 87/117 (74%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KN+ +G A++ STFNNT +TITDP+G+ ++W+S    GF G++K +PFAAQ+A +  + 
Sbjct: 12  KKNVPNGVAYIQSTFNNTIVTITDPNGDVVSWASAGSTGFKGAKKGTPFAAQMAAESAAR 71

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +A  +GM  +EV VSG GAGR++A+RAL+A G  I  I D+T I HNGCRP KRRR+
Sbjct: 72  QAMENGMRQIEVMVSGPGAGRETAIRALQATGLEITLIRDITPIPHNGCRPPKRRRV 128


>gi|89898700|ref|YP_515810.1| 30S ribosomal protein S11 [Chlamydophila felis Fe/C-56]
 gi|123763200|sp|Q252X3|RS11_CHLFF RecName: Full=30S ribosomal protein S11
 gi|89332072|dbj|BAE81665.1| 30S ribosomal protein S11 [Chlamydophila felis Fe/C-56]
          Length = 132

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 86/122 (70%)

Query: 8   IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
           ++ ++ KNI SG  HV +TFNNT ++ITDP GN I+W+S   VG+SGSRK+S FAA VA 
Sbjct: 11  VKRKQLKNIPSGVVHVKATFNNTIVSITDPAGNVISWASAGKVGYSGSRKSSAFAATVAA 70

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
            D +  A N G+  +EV + G GAGR+SA+RAL A G  +  I D T + HNGCRPRKRR
Sbjct: 71  QDAAKNAMNSGLKEVEVCLKGTGAGRESAVRALIAAGLVVSVIRDETPVPHNGCRPRKRR 130

Query: 128 RI 129
           R+
Sbjct: 131 RV 132


>gi|325287072|ref|YP_004262862.1| 30S ribosomal protein S11 [Cellulophaga lytica DSM 7489]
 gi|324322526|gb|ADY29991.1| 30S ribosomal protein S11 [Cellulophaga lytica DSM 7489]
          Length = 130

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/121 (48%), Positives = 84/121 (69%), Gaps = 2/121 (1%)

Query: 11  RERKNIVS--GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           ++RK IV   G AHV ++FNN  I++T+  G+ I+WSS   +GF GS+KN+P+AAQVA++
Sbjct: 10  KKRKVIVESVGEAHVTASFNNIIISLTNKKGDVISWSSAGKMGFRGSKKNTPYAAQVASE 69

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           DC+  A   G+  ++V V G G GR+SA+RA+   G  +  I DVT + HNGCRP KRRR
Sbjct: 70  DCAKVAHEAGLRKVKVYVKGPGNGRESAIRAIHNSGIEVTEIIDVTPLPHNGCRPPKRRR 129

Query: 129 I 129
           +
Sbjct: 130 V 130


>gi|86158344|ref|YP_465129.1| 30S ribosomal protein S11 [Anaeromyxobacter dehalogenans 2CP-C]
 gi|123723039|sp|Q2IJ64|RS11_ANADE RecName: Full=30S ribosomal protein S11
 gi|85774855|gb|ABC81692.1| SSU ribosomal protein S11P [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 127

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/126 (59%), Positives = 90/126 (71%)

Query: 4   SPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAA 63
           +P + + R +KNI +G  H+ STFNNT+ITITD  GN IAWSS    GF GSRK++PFAA
Sbjct: 2   TPKKGKKRVKKNIAAGIVHIASTFNNTQITITDVTGNVIAWSSAGARGFKGSRKSTPFAA 61

Query: 64  QVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRP 123
           QVA  D +AKA  HG+ ++ V V G GAGR+SALRAL A G  I  I DVT I HNGCRP
Sbjct: 62  QVAAGDAAAKAMEHGLKTVSVVVKGPGAGRESALRALSAAGLKITLIRDVTPIPHNGCRP 121

Query: 124 RKRRRI 129
            KRRR+
Sbjct: 122 PKRRRV 127


>gi|94500969|ref|ZP_01307494.1| 30S ribosomal protein S11 [Oceanobacter sp. RED65]
 gi|94426909|gb|EAT11892.1| 30S ribosomal protein S11 [Oceanobacter sp. RED65]
          Length = 129

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 80/109 (73%)

Query: 21  AHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMS 80
           AH+ ++FNNT +TITD  GN ++W++    GF GSRK++PFAAQVA +     A+ +G+ 
Sbjct: 21  AHIHASFNNTIVTITDRQGNALSWATAGGSGFRGSRKSTPFAAQVAAERAGEAAKEYGLK 80

Query: 81  SLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +L+V+V G G GR+SA+RAL A G+ I +I DVT I HNGCRP K+RR+
Sbjct: 81  NLDVEVKGPGPGRESAVRALNACGYKIGNITDVTPIPHNGCRPPKKRRV 129


>gi|225024811|ref|ZP_03714003.1| hypothetical protein EIKCOROL_01698 [Eikenella corrodens ATCC
           23834]
 gi|224942414|gb|EEG23623.1| hypothetical protein EIKCOROL_01698 [Eikenella corrodens ATCC
           23834]
          Length = 131

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 89/124 (71%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R R + RK +  G  H+ ++FNNT ITITD  GN ++W++    GF GSRK++PFAAQV
Sbjct: 8   ARTRKKVRKVVNDGIVHIHASFNNTIITITDRQGNVLSWATSGGAGFKGSRKSTPFAAQV 67

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +     AQ +G+ +LEV++ G G GR+S++R+L AIGF IVSI DVT + HNGCRP K
Sbjct: 68  AAEAAGKAAQEYGVKNLEVRIKGPGPGRESSVRSLNAIGFKIVSITDVTPLPHNGCRPPK 127

Query: 126 RRRI 129
           +RRI
Sbjct: 128 KRRI 131


>gi|169823877|ref|YP_001691488.1| 30S ribosomal protein S11 [Finegoldia magna ATCC 29328]
 gi|297588217|ref|ZP_06946861.1| 30S ribosomal protein S11 [Finegoldia magna ATCC 53516]
 gi|302379830|ref|ZP_07268314.1| 30S ribosomal protein S11 [Finegoldia magna ACS-171-V-Col3]
 gi|303234767|ref|ZP_07321393.1| 30S ribosomal protein S11 [Finegoldia magna BVS033A4]
 gi|167830682|dbj|BAG07598.1| 30S ribosomal protein S11 [Finegoldia magna ATCC 29328]
 gi|297574906|gb|EFH93626.1| 30S ribosomal protein S11 [Finegoldia magna ATCC 53516]
 gi|302312418|gb|EFK94415.1| 30S ribosomal protein S11 [Finegoldia magna ACS-171-V-Col3]
 gi|302494108|gb|EFL53888.1| 30S ribosomal protein S11 [Finegoldia magna BVS033A4]
          Length = 135

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 91/123 (73%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R + R +KNI  G+AH+ STFNNT + +TD +GN ++W+S   +GF GSRK++P+AAQ A
Sbjct: 13  RGKKRVKKNIEKGQAHISSTFNNTMVCLTDLNGNVLSWASAGQLGFRGSRKSTPYAAQQA 72

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            ++ + KA  HG+ ++EV V G G+GR+SA+R+L+A G  + SI DVT I HNGCRP K+
Sbjct: 73  AEEAAKKAMEHGLKTVEVYVKGPGSGRESAIRSLQASGLEVSSIKDVTPIPHNGCRPPKK 132

Query: 127 RRI 129
           RR+
Sbjct: 133 RRV 135


>gi|238855093|ref|ZP_04645421.1| 30S ribosomal protein S11 [Lactobacillus jensenii 269-3]
 gi|256852061|ref|ZP_05557448.1| 30S ribosomal protein S11 [Lactobacillus jensenii 27-2-CHN]
 gi|260661370|ref|ZP_05862283.1| 30S ribosomal protein S11 [Lactobacillus jensenii 115-3-CHN]
 gi|260664878|ref|ZP_05865729.1| 30S ribosomal protein S11 [Lactobacillus jensenii SJ-7A-US]
 gi|282931914|ref|ZP_06337386.1| 30S ribosomal protein S11 [Lactobacillus jensenii 208-1]
 gi|282932824|ref|ZP_06338224.1| 30S ribosomal protein S11 [Lactobacillus jensenii 208-1]
 gi|297205064|ref|ZP_06922460.1| 30S ribosomal protein S11 [Lactobacillus jensenii JV-V16]
 gi|313472572|ref|ZP_07813061.1| 30S ribosomal protein S11 [Lactobacillus jensenii 1153]
 gi|238832337|gb|EEQ24646.1| 30S ribosomal protein S11 [Lactobacillus jensenii 269-3]
 gi|239530012|gb|EEQ69013.1| 30S ribosomal protein S11 [Lactobacillus jensenii 1153]
 gi|256615473|gb|EEU20663.1| 30S ribosomal protein S11 [Lactobacillus jensenii 27-2-CHN]
 gi|260547825|gb|EEX23802.1| 30S ribosomal protein S11 [Lactobacillus jensenii 115-3-CHN]
 gi|260561361|gb|EEX27334.1| 30S ribosomal protein S11 [Lactobacillus jensenii SJ-7A-US]
 gi|281303053|gb|EFA95255.1| 30S ribosomal protein S11 [Lactobacillus jensenii 208-1]
 gi|281303966|gb|EFA96096.1| 30S ribosomal protein S11 [Lactobacillus jensenii 208-1]
 gi|297149642|gb|EFH29939.1| 30S ribosomal protein S11 [Lactobacillus jensenii JV-V16]
          Length = 129

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 64/129 (49%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           MP   +  + R +K++ SG AH+ STFNNT + ITD  GN +AWSS   +GF GSRK++P
Sbjct: 1   MPAKKNTRKRRVKKHVESGVAHIHSTFNNTLVMITDVQGNAVAWSSAGALGFKGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  +  + + GM  +EV V G GAGR++A+R+L+A G  I +I DVT + HNG
Sbjct: 61  FAAQMAAEAAAKASMDQGMKHVEVSVKGPGAGREAAIRSLQATGLEITAIRDVTPVPHNG 120

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 121 SRPPKRRRV 129


>gi|255659527|ref|ZP_05404936.1| 30S ribosomal protein S11 [Mitsuokella multacida DSM 20544]
 gi|260848080|gb|EEX68087.1| 30S ribosomal protein S11 [Mitsuokella multacida DSM 20544]
          Length = 130

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 88/127 (69%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K   R + + RKNI  G AH+ STFNNT +T+TD  GN ++W+S   +GF GSRK++PFA
Sbjct: 4   KKAVRTKKKVRKNIEYGVAHISSTFNNTIVTLTDKSGNALSWASAGGLGFRGSRKSTPFA 63

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  +  A  HG+  +EV V G GAGR++A+R+L+A G  +  I DVT I HNGCR
Sbjct: 64  AQMAAETAAKAAMEHGLKQVEVYVKGPGAGREAAIRSLQATGLEVNMIKDVTPIPHNGCR 123

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 124 PPKRRRV 130


>gi|146298137|ref|YP_001192728.1| 30S ribosomal protein S11 [Flavobacterium johnsoniae UW101]
 gi|189040415|sp|A5FN17|RS11_FLAJO RecName: Full=30S ribosomal protein S11
 gi|146152555|gb|ABQ03409.1| 30S ribosomal protein S11 [Flavobacterium johnsoniae UW101]
          Length = 127

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 83/121 (68%), Gaps = 2/121 (1%)

Query: 11  RERKNIV--SGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           ++RK IV  +G AH+ STFNN  I++T+  G  IAWSS   +GF GS+KN+P+AAQ+A +
Sbjct: 7   KKRKVIVESTGEAHISSTFNNIIISLTNKKGEVIAWSSAGKMGFRGSKKNTPYAAQMAAE 66

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           DCS  A   G+  ++V V G G GR+SA+R++   G  +  I DVT + HNGCRP KRRR
Sbjct: 67  DCSKVALEAGLKKVKVYVKGPGNGRESAIRSIHNGGIEVTEIIDVTPMPHNGCRPPKRRR 126

Query: 129 I 129
           +
Sbjct: 127 V 127


>gi|118474117|ref|YP_891267.1| 30S ribosomal protein S11 [Campylobacter fetus subsp. fetus 82-40]
 gi|152060581|sp|A0RM34|RS11_CAMFF RecName: Full=30S ribosomal protein S11
 gi|118413343|gb|ABK81763.1| ribosomal protein S11 [Campylobacter fetus subsp. fetus 82-40]
          Length = 130

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 83/116 (71%), Gaps = 1/116 (0%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI  G  ++ +TFNNT +T+TD  GN IAWSS   +GF GS+K++P+AAQ A +D   KA
Sbjct: 15  NIAKGIVYISATFNNTMVTVTDEMGNAIAWSSAGGLGFKGSKKSTPYAAQQAVEDAMNKA 74

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAI-GFTIVSICDVTMIAHNGCRPRKRRRI 129
           + HG+  + +KV G G+GR++A++++  + G  ++ + D+T +AHNGCRP KRRR+
Sbjct: 75  KEHGIKEVGIKVQGPGSGRETAVKSIGGVEGIKVLYLKDITPLAHNGCRPPKRRRV 130


>gi|317125842|ref|YP_004099954.1| 30S ribosomal protein S11P [Intrasporangium calvum DSM 43043]
 gi|315589930|gb|ADU49227.1| SSU ribosomal protein S11P [Intrasporangium calvum DSM 43043]
          Length = 131

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 63/124 (50%), Positives = 89/124 (71%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +++R +E+KN+  G AH+ STFNNT I+ITDP G  IAW+S   VGF GSRK++P+AAQ+
Sbjct: 8   TKVRRKEKKNVAHGHAHIKSTFNNTIISITDPTGAVIAWASAGQVGFKGSRKSTPYAAQM 67

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  + +A  HGM  ++V V G G+GR++A+R+L A G  + +I DVT   HNG RP K
Sbjct: 68  AAEAAARRAMEHGMRKVDVFVKGPGSGRETAIRSLTAAGLEVGAISDVTPTPHNGVRPPK 127

Query: 126 RRRI 129
           RRR+
Sbjct: 128 RRRV 131


>gi|331004907|ref|ZP_08328323.1| SSU ribosomal protein S11p (S14e) [gamma proteobacterium IMCC1989]
 gi|330421294|gb|EGG95544.1| SSU ribosomal protein S11p (S14e) [gamma proteobacterium IMCC1989]
          Length = 127

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 80/111 (72%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G AH+ ++FNNT +TITD  GN ++W++    GF GSRK++PFAAQVA +     A  +G
Sbjct: 17  GIAHIHASFNNTIVTITDRQGNALSWATAGGSGFRGSRKSTPFAAQVAAERAGQAALEYG 76

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + +L+V+V G G GR+SA+RAL  +G+ I +I DVT I HNGCRP K+RR+
Sbjct: 77  LKNLDVEVKGPGPGRESAVRALNNVGYKIANITDVTPIPHNGCRPPKKRRV 127


>gi|58336654|ref|YP_193239.1| 30S ribosomal protein S11 [Lactobacillus acidophilus NCFM]
 gi|75358064|sp|Q5FM66|RS11_LACAC RecName: Full=30S ribosomal protein S11
 gi|58253971|gb|AAV42208.1| 30S ribosomal protein S11 [Lactobacillus acidophilus NCFM]
          Length = 130

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/128 (51%), Positives = 88/128 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           MP   +  + R +K++ SG AH+ STFNNT + ITD  GN +AWSS   +GF GSRK++P
Sbjct: 2   MPAKKTARKRRVKKHVESGVAHIHSTFNNTLVMITDVQGNAVAWSSAGALGFKGSRKSTP 61

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQ+A +  +  A + GM  +EV V G GAGR+SA+R+L+A G  I +I DVT + HNG
Sbjct: 62  FAAQMAAEAAAKSAMDQGMKHVEVSVKGPGAGRESAIRSLQATGLEITAIRDVTPVPHNG 121

Query: 121 CRPRKRRR 128
            RP KRRR
Sbjct: 122 SRPPKRRR 129


>gi|319944772|ref|ZP_08019036.1| 30S ribosomal protein S11 [Lautropia mirabilis ATCC 51599]
 gi|319742021|gb|EFV94444.1| 30S ribosomal protein S11 [Lautropia mirabilis ATCC 51599]
          Length = 137

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 89/123 (72%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R R + +KN+  G AHV ++FNNT ITITD  GNT++W++    GF GSRK++PFAAQVA
Sbjct: 15  RARKKVKKNVSDGIAHVHASFNNTIITITDRQGNTLSWATSGGAGFRGSRKSTPFAAQVA 74

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +     A  +G+ +L+V++ G G GRDS++RAL A+G  I+SI DVT + HNGCRP K+
Sbjct: 75  AEAAGRVAIEYGIKNLDVRIKGPGPGRDSSVRALNALGIKILSISDVTPVPHNGCRPPKK 134

Query: 127 RRI 129
           RRI
Sbjct: 135 RRI 137


>gi|119029439|gb|ABL59936.1| ribosomal protein S11 [uncultured bacterium]
          Length = 134

 Score =  122 bits (306), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 81/122 (66%), Gaps = 1/122 (0%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +++K    G  H+ +TFNNT+ITITD  GN IAWSS    GF GSRK++PFAAQVA D
Sbjct: 13  RKKDKKYYSDGIVHIKATFNNTKITITDTQGNVIAWSSSAKAGFKGSRKSTPFAAQVAAD 72

Query: 69  DCSAKA-QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
           + +       G+  ++V V+G G+GR+SA+RAL   G  +  I DVT I HNGCR  K+R
Sbjct: 73  EVAKDCIDRFGLKKVQVWVNGPGSGRESAVRALSGAGLRVSEIKDVTGIPHNGCRDPKKR 132

Query: 128 RI 129
           R+
Sbjct: 133 RV 134


>gi|253681894|ref|ZP_04862691.1| 30S ribosomal protein S11 [Clostridium botulinum D str. 1873]
 gi|331268440|ref|YP_004394932.1| 30S ribosomal protein S11 [Clostridium botulinum BKT015925]
 gi|253561606|gb|EES91058.1| 30S ribosomal protein S11 [Clostridium botulinum D str. 1873]
 gi|329124990|gb|AEB74935.1| ribosomal protein S11 [Clostridium botulinum BKT015925]
          Length = 131

 Score =  122 bits (306), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 64/115 (55%), Positives = 83/115 (72%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI  G AH+ STFNN+ +TITD  GN ++WSS   +GF GSRK++PFAAQ+A +  +  A
Sbjct: 17  NIEHGCAHIKSTFNNSIVTITDAVGNALSWSSAGALGFKGSRKSTPFAAQMAAETAATSA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ S+EV V G GAGR++A+R+L+A G  I  I DVT I HNGCRP KRRR+
Sbjct: 77  MEHGLKSIEVYVKGPGAGREAAIRSLQAAGLEITLIKDVTPIPHNGCRPPKRRRV 131


>gi|298531062|ref|ZP_07018463.1| 30S ribosomal protein S11 [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298509085|gb|EFI32990.1| 30S ribosomal protein S11 [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 129

 Score =  122 bits (306), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 80/115 (69%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI +G  H+ ++FNNT +TITD  GN ++WSS  +VGF GSRK +PFA+Q A +  +  A
Sbjct: 15  NIPTGIVHINASFNNTTVTITDQTGNVVSWSSSGMVGFKGSRKGTPFASQKAAETAARLA 74

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             +GM ++ + V G GAGR+SA+RA+   GF +  I D+T I HNGCRP KRRR+
Sbjct: 75  HENGMRTVGILVKGPGAGRESAMRAINTSGFKVTYIRDITPIPHNGCRPPKRRRV 129


>gi|15837776|ref|NP_298464.1| 30S ribosomal protein S11 [Xylella fastidiosa 9a5c]
 gi|48474998|sp|Q9PE54|RS11_XYLFA RecName: Full=30S ribosomal protein S11
 gi|9106140|gb|AAF83984.1|AE003951_9 30S ribosomal protein S11 [Xylella fastidiosa 9a5c]
          Length = 130

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 79/111 (71%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G AH+ ++FNNT +TITD  GN++ W +    GF GSRK +PFAAQVA +       ++G
Sbjct: 20  GVAHISASFNNTIVTITDRQGNSLFWCTSGASGFRGSRKCTPFAAQVAAEKAGRAVLDYG 79

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           M SLEV+++G G GR+SA+R+L  +G+ I +I DVT I HNGCRP K+RR+
Sbjct: 80  MKSLEVRINGPGPGRESAVRSLNNVGYKITNIIDVTPIPHNGCRPPKKRRV 130


>gi|315655842|ref|ZP_07908740.1| 30S ribosomal protein S11 [Mobiluncus curtisii ATCC 51333]
 gi|315489906|gb|EFU79533.1| 30S ribosomal protein S11 [Mobiluncus curtisii ATCC 51333]
          Length = 131

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 89/124 (71%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           ++ R +ERKN+  G A++ STFNNT ++ITDP G  +AWSS   VGF GSRK++PFAAQ+
Sbjct: 8   TKSRRKERKNVTEGNAYIKSTFNNTIVSITDPSGAVLAWSSSGQVGFKGSRKSTPFAAQL 67

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  + +AQ  G+  ++V V G G+GR++A+R L A G  + SI DVT  AHNGCRP K
Sbjct: 68  AAEAAARRAQEFGLKKVDVFVKGPGSGRETAIRTLTATGLEVGSIQDVTPQAHNGCRPPK 127

Query: 126 RRRI 129
           RRR+
Sbjct: 128 RRRV 131


>gi|225011670|ref|ZP_03702108.1| ribosomal protein S11 [Flavobacteria bacterium MS024-2A]
 gi|225004173|gb|EEG42145.1| ribosomal protein S11 [Flavobacteria bacterium MS024-2A]
          Length = 127

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 84/122 (68%), Gaps = 2/122 (1%)

Query: 10  NRERKNIVS--GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
           +++RK IV   G AHV ++FNN  I++T+  G  I+WSS   +GF GS+KN+P+AAQ A 
Sbjct: 6   SKKRKVIVESIGEAHVTASFNNIIISLTNTKGEVISWSSAGKMGFRGSKKNTPYAAQTAA 65

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
           +DC+  AQ  G+  ++V V G G GR+SA+R+L   G  ++ I D+T + HNGCRP KRR
Sbjct: 66  EDCAKVAQEAGLRKVKVFVKGPGNGRESAIRSLHNAGIEVMEIVDITPLPHNGCRPPKRR 125

Query: 128 RI 129
           R+
Sbjct: 126 RV 127


>gi|323342813|ref|ZP_08083045.1| 30S ribosomal protein S11 [Erysipelothrix rhusiopathiae ATCC 19414]
 gi|322463925|gb|EFY09119.1| 30S ribosomal protein S11 [Erysipelothrix rhusiopathiae ATCC 19414]
          Length = 129

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 85/120 (70%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R RKNI  G AH+ STFNNT +TI+D  GN IAWSS   +GF GSRK++P+AAQ+A++
Sbjct: 9   KRRVRKNIARGVAHIHSTFNNTIVTISDEQGNVIAWSSAGALGFKGSRKSTPYAAQMASE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A +HGM ++EV V G G GR+SA+RAL+  G  I  I DVT + HNGCRP KR R
Sbjct: 69  AAAKAAVDHGMKTVEVSVKGPGPGRESAVRALQVAGLEISVINDVTPVPHNGCRPPKRPR 128


>gi|67923561|ref|ZP_00517034.1| Ribosomal protein S11 [Crocosphaera watsonii WH 8501]
 gi|67854587|gb|EAM49873.1| Ribosomal protein S11 [Crocosphaera watsonii WH 8501]
          Length = 130

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/119 (53%), Positives = 85/119 (71%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           R++KN+ +G AH+ STFNNT ITI+D  G+ ++WSS    GF G++K +PFAAQ A D  
Sbjct: 12  RQKKNVPNGVAHIQSTFNNTIITISDTKGDVVSWSSAGASGFKGAKKGTPFAAQTAADSA 71

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + +A + GM  +EV VSG GAGR++A+RAL+  G  I  I DVT I HNGCRP KRRR+
Sbjct: 72  ARRAIDQGMRQIEVMVSGPGAGRETAIRALQGAGLEITLIRDVTPIPHNGCRPPKRRRV 130


>gi|153004798|ref|YP_001379123.1| 30S ribosomal protein S11 [Anaeromyxobacter sp. Fw109-5]
 gi|152028371|gb|ABS26139.1| ribosomal protein S11 [Anaeromyxobacter sp. Fw109-5]
          Length = 159

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/128 (57%), Positives = 89/128 (69%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           P +P + + R +KNI +G  H+ STFNNT ITI D  GN I+WSS    GF GSRK++PF
Sbjct: 32  PVTPKKGKKRVKKNIATGIVHIASTFNNTMITICDASGNVISWSSAGARGFKGSRKSTPF 91

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQVA  D +AKA  HG+ ++ V V G GAGR+SALRAL A G  I  I DVT I HNGC
Sbjct: 92  AAQVAAGDAAAKAMEHGLKTVSVVVKGPGAGRESALRALSAAGLKITLIRDVTPIPHNGC 151

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 152 RPPKRRRV 159


>gi|330444133|ref|YP_004377119.1| 30S ribosomal protein S11 [Chlamydophila pecorum E58]
 gi|328807243|gb|AEB41416.1| ribosomal protein S11 [Chlamydophila pecorum E58]
          Length = 133

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 86/122 (70%)

Query: 8   IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
           I+ ++ KN+ SG  HV +TFNNT ++ITDP GN I+W+S   VG+SGSRK+S FAA VA 
Sbjct: 12  IKRKQSKNVPSGVVHVKATFNNTIVSITDPAGNVISWASAGKVGYSGSRKSSAFAATVAA 71

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
            D +  A N G+  +EV + G GAGR+SA+RAL + G  +  I D T + HNGCRPRKRR
Sbjct: 72  QDAAKIAMNFGLKEVEVSLKGTGAGRESAVRALISSGLIVSVIRDETPVPHNGCRPRKRR 131

Query: 128 RI 129
           R+
Sbjct: 132 RV 133


>gi|322436520|ref|YP_004218732.1| 30S ribosomal protein S11 [Acidobacterium sp. MP5ACTX9]
 gi|321164247|gb|ADW69952.1| 30S ribosomal protein S11 [Acidobacterium sp. MP5ACTX9]
          Length = 142

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 87/123 (70%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           + + RERKN+  G   + ++FNNT +TITD  GNTI+W S   +GF GSRK +PFAAQ A
Sbjct: 20  KFKKRERKNVPYGLVFIQASFNNTIVTITDQTGNTISWKSSGSLGFRGSRKGTPFAAQQA 79

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
               +  A++HG+ S++V+VSG G+GR+SA+RAL   G  + SI DVT + HNGCRP KR
Sbjct: 80  AVGAANAARDHGLRSVDVRVSGPGSGRESAIRALATAGIDVRSIRDVTPMPHNGCRPPKR 139

Query: 127 RRI 129
           RR+
Sbjct: 140 RRV 142


>gi|261854972|ref|YP_003262255.1| 30S ribosomal protein S11 [Halothiobacillus neapolitanus c2]
 gi|261835441|gb|ACX95208.1| 30S ribosomal protein S11 [Halothiobacillus neapolitanus c2]
          Length = 129

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/129 (44%), Positives = 88/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M KS +  R + ++ +    AHV ++FNNT +TITD  GN ++W++    GF GSRK++P
Sbjct: 1   MAKSNAPARKKIKRVVTDAVAHVHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA +     A+ +G+ +++V++ G G GR+S +RAL ++GF +  I DVT I HNG
Sbjct: 61  FAAQVAAERAGEAAKAYGVKNIDVEIKGPGPGRESTIRALNSVGFKVGVITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|313680489|ref|YP_004058228.1| SSU ribosomal protein s11p [Oceanithermus profundus DSM 14977]
 gi|313153204|gb|ADR37055.1| SSU ribosomal protein S11P [Oceanithermus profundus DSM 14977]
          Length = 131

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/120 (51%), Positives = 86/120 (71%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R + +K +  G+A + +T+NNT ITITD  GN + WSS  V+G+ GSRK +P+AAQ+A  
Sbjct: 11  RKKVKKQVAHGKAFIHATYNNTIITITDLDGNPVTWSSGGVIGYKGSRKGTPYAAQLAAM 70

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           D + KAQN GM+ ++V V G GAGR+ A+RAL+A G  + SI D T + HNGCRPRK++R
Sbjct: 71  DAAKKAQNFGMTQVDVVVRGTGAGREQAIRALQASGLQVRSIVDDTPVPHNGCRPRKKKR 130


>gi|28493496|ref|NP_787657.1| 30S ribosomal protein S11 [Tropheryma whipplei str. Twist]
 gi|28572391|ref|NP_789171.1| 30S ribosomal protein S11 [Tropheryma whipplei TW08/27]
 gi|54039339|sp|P66366|RS11_TROW8 RecName: Full=30S ribosomal protein S11
 gi|54042113|sp|P66365|RS11_TROWT RecName: Full=30S ribosomal protein S11
 gi|28410522|emb|CAD66908.1| 30S ribosomal protein S11 [Tropheryma whipplei TW08/27]
 gi|28476538|gb|AAO44626.1| 30S ribosomal protein S11 [Tropheryma whipplei str. Twist]
          Length = 130

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/127 (51%), Positives = 89/127 (70%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           ++ SR R + RKNI +G AH+ STFNNT +TITD  GN I WSS   VGF GSRK++P+A
Sbjct: 4   QAQSRSRKKARKNIPAGLAHIKSTFNNTIVTITDLSGNVIGWSSSGAVGFKGSRKSTPYA 63

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A D  +  AQ HG+  ++V V G G+GR++A+R+L+  G  I SI D T +A NGCR
Sbjct: 64  AQMAADAAARSAQEHGVKKVDVFVKGPGSGRETAIRSLQTAGLEIGSISDTTPLAFNGCR 123

Query: 123 PRKRRRI 129
           P K+R +
Sbjct: 124 PPKKRLV 130


>gi|184200288|ref|YP_001854495.1| 30S ribosomal protein S11 [Kocuria rhizophila DC2201]
 gi|254765387|sp|B2GJ19|RS11_KOCRD RecName: Full=30S ribosomal protein S11
 gi|183580518|dbj|BAG28989.1| 30S ribosomal protein S11 [Kocuria rhizophila DC2201]
          Length = 134

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 87/121 (71%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +  KN+  G+AH+ STFNNT ++ITDP G  ++W+S   +GF GSRK++PFAAQ A +
Sbjct: 14  RRKVNKNVTQGQAHIKSTFNNTIVSITDPSGAVLSWASAGGMGFKGSRKSTPFAAQQAAE 73

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  AQ HGM  ++V V G G+GR++A+RAL+A G  + SI DVT  AHNGCRP KRRR
Sbjct: 74  AAAKGAQEHGMRKVDVFVKGPGSGRETAIRALQATGLEVGSIQDVTPSAHNGCRPPKRRR 133

Query: 129 I 129
           +
Sbjct: 134 V 134


>gi|326793581|ref|YP_004311401.1| 30S ribosomal protein S11 [Marinomonas mediterranea MMB-1]
 gi|326544345|gb|ADZ89565.1| 30S ribosomal protein S11 [Marinomonas mediterranea MMB-1]
          Length = 130

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 80/111 (72%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G AHV ++FNNT +TITD  GN ++W++    GF GSRK++PFAAQVA +   A AQ  G
Sbjct: 20  GVAHVHASFNNTIVTITDRQGNALSWATAGGSGFRGSRKSTPFAAQVAAERAGAVAQEFG 79

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + +++V + G G GR+SA+RAL A+G  I +I DVT I HNGCRP K+RR+
Sbjct: 80  LKNVDVMIKGPGPGRESAVRALNALGLRINNITDVTPIPHNGCRPPKKRRV 130


>gi|311693293|gb|ADP96166.1| ribosomal protein S11, bacterial-type [marine bacterium HP15]
          Length = 118

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 84/117 (71%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +K +V G AH+ ++FNNT +TI+D  GN ++W++    GF GSRK++PFAAQVA +    
Sbjct: 2   KKTVVDGVAHIHASFNNTIVTISDRQGNVLSWATSGGSGFRGSRKSTPFAAQVAAERAGN 61

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
            A  +G+ +L+V+V G G GR+SA+RAL A G+ I +I DVT I HNGCRP K+RR+
Sbjct: 62  AAAEYGLKNLDVEVKGPGPGRESAVRALNACGYKITNITDVTPIPHNGCRPPKKRRV 118


>gi|15618537|ref|NP_224823.1| 30S ribosomal protein S11 [Chlamydophila pneumoniae CWL029]
 gi|15836159|ref|NP_300683.1| 30S ribosomal protein S11 [Chlamydophila pneumoniae J138]
 gi|16752413|ref|NP_444672.1| 30S ribosomal protein S11 [Chlamydophila pneumoniae AR39]
 gi|33241984|ref|NP_876925.1| 30S ribosomal protein S11 [Chlamydophila pneumoniae TW-183]
 gi|6831657|sp|Q9Z7S7|RS11_CHLPN RecName: Full=30S ribosomal protein S11
 gi|4376925|gb|AAD18766.1| S11 Ribosomal Protein [Chlamydophila pneumoniae CWL029]
 gi|7189054|gb|AAF38003.1| ribosomal protein S11 [Chlamydophila pneumoniae AR39]
 gi|8978999|dbj|BAA98834.1| S11 ribosomal protein [Chlamydophila pneumoniae J138]
 gi|33236494|gb|AAP98582.1| ribosomal protein S11 [Chlamydophila pneumoniae TW-183]
 gi|269302411|gb|ACZ32511.1| ribosomal protein S11 [Chlamydophila pneumoniae LPCoLN]
          Length = 133

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 86/122 (70%)

Query: 8   IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
           ++ ++ KNI SG  HV +TFNNT ++ITDP GN I+W+S   VG+SGSRK+S FAA VA 
Sbjct: 12  VKRKQLKNIPSGVVHVKATFNNTIVSITDPAGNVISWASAGKVGYSGSRKSSAFAATVAA 71

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
            D +  A N G+  +EV + G GAGR+SA+RAL + G  +  I D T + HNGCRPRKRR
Sbjct: 72  QDAAKTAMNSGLKEVEVCLKGTGAGRESAVRALISAGLVVSVIRDETPVPHNGCRPRKRR 131

Query: 128 RI 129
           R+
Sbjct: 132 RV 133


>gi|87122792|ref|ZP_01078665.1| 30S ribosomal protein S11 [Marinomonas sp. MED121]
 gi|86161957|gb|EAQ63249.1| 30S ribosomal protein S11 [Marinomonas sp. MED121]
          Length = 130

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 80/111 (72%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G AHV ++FNNT +TITD  GN ++W++    GF GSRK++PFAAQVA +   A AQ  G
Sbjct: 20  GVAHVHASFNNTIVTITDRQGNALSWATAGGSGFRGSRKSTPFAAQVAAERAGAVAQEFG 79

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + +++V + G G GR+SA+RAL A+G  I +I DVT I HNGCRP K+RR+
Sbjct: 80  LKNVDVMIKGPGPGRESAVRALNALGLRINNITDVTPIPHNGCRPPKKRRV 130


>gi|239905882|ref|YP_002952621.1| 30S ribosomal protein S11 [Desulfovibrio magneticus RS-1]
 gi|259494621|sp|C4XLK1|RS11_DESMR RecName: Full=30S ribosomal protein S11
 gi|239795746|dbj|BAH74735.1| 30S ribosomal protein S11 [Desulfovibrio magneticus RS-1]
          Length = 128

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 88/125 (70%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P R   +ERKNI  G AH+ +TFNNT +T TD  GN ++W++    GF GSRK++PFAAQ
Sbjct: 4   PRRTGKKERKNIPVGVAHIQATFNNTIVTFTDQKGNVVSWATSGGAGFKGSRKSTPFAAQ 63

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           VA ++ + KAQ +GM ++ V V G G+GR++A+RA+   GF I  I D+T I HNGCRP 
Sbjct: 64  VAAENAARKAQENGMRTVGVLVKGPGSGREAAMRAIHNAGFKISYIRDITPIPHNGCRPP 123

Query: 125 KRRRI 129
           KRRR+
Sbjct: 124 KRRRV 128


>gi|92112577|ref|YP_572505.1| 30S ribosomal protein S11 [Chromohalobacter salexigens DSM 3043]
 gi|123084226|sp|Q1R0F2|RS11_CHRSD RecName: Full=30S ribosomal protein S11
 gi|91795667|gb|ABE57806.1| SSU ribosomal protein S11P [Chromohalobacter salexigens DSM 3043]
          Length = 128

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/126 (46%), Positives = 87/126 (69%)

Query: 4   SPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAA 63
           +P   R + +K +V   AH+ ++FNNT +TITD  GN ++W++    GF GSRK++PFAA
Sbjct: 3   NPRSNRKKVKKQVVDAVAHIHASFNNTIVTITDRQGNALSWATAGGSGFRGSRKSTPFAA 62

Query: 64  QVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRP 123
           QVA++  +  A  +G+ +++V V G G GR+SA+RAL A GF + SI D T + HNGCRP
Sbjct: 63  QVASERAATAAAEYGVKNVDVLVKGPGPGRESAVRALNAAGFRVQSITDATPVPHNGCRP 122

Query: 124 RKRRRI 129
            K+RR+
Sbjct: 123 PKKRRV 128


>gi|42518454|ref|NP_964384.1| 30S ribosomal protein S11 [Lactobacillus johnsonii NCC 533]
 gi|116628987|ref|YP_814159.1| 30S ribosomal protein S11 [Lactobacillus gasseri ATCC 33323]
 gi|227888828|ref|ZP_04006633.1| ribosomal protein S11 [Lactobacillus johnsonii ATCC 33200]
 gi|238853458|ref|ZP_04643836.1| 30S ribosomal protein S11 [Lactobacillus gasseri 202-4]
 gi|268318876|ref|YP_003292532.1| ribosomal protein S11 [Lactobacillus johnsonii FI9785]
 gi|282852674|ref|ZP_06262016.1| 30S ribosomal protein S11 [Lactobacillus gasseri 224-1]
 gi|311111215|ref|ZP_07712612.1| 30S ribosomal protein S11 [Lactobacillus gasseri MV-22]
 gi|62287450|sp|Q74L65|RS11_LACJO RecName: Full=30S ribosomal protein S11
 gi|122274015|sp|Q046A1|RS11_LACGA RecName: Full=30S ribosomal protein S11
 gi|41582739|gb|AAS08350.1| 30S ribosomal protein S11 [Lactobacillus johnsonii NCC 533]
 gi|116094569|gb|ABJ59721.1| SSU ribosomal protein S11P [Lactobacillus gasseri ATCC 33323]
 gi|227850665|gb|EEJ60751.1| ribosomal protein S11 [Lactobacillus johnsonii ATCC 33200]
 gi|238833898|gb|EEQ26157.1| 30S ribosomal protein S11 [Lactobacillus gasseri 202-4]
 gi|262397251|emb|CAX66265.1| ribosomal protein S11 [Lactobacillus johnsonii FI9785]
 gi|282556416|gb|EFB62036.1| 30S ribosomal protein S11 [Lactobacillus gasseri 224-1]
 gi|311066369|gb|EFQ46709.1| 30S ribosomal protein S11 [Lactobacillus gasseri MV-22]
 gi|329666717|gb|AEB92665.1| 30S ribosomal protein S11 [Lactobacillus johnsonii DPC 6026]
          Length = 129

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 86/121 (71%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R +K++ SG AH+ STFNNT + ITD  GN +AWSS   +GF GSRK++PFAAQ+A +
Sbjct: 9   KRRVKKHVESGVAHIHSTFNNTLVMITDVQGNAVAWSSAGALGFKGSRKSTPFAAQMAAE 68

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A + GM  +EV V G GAGR++A+RAL+A G  I +I DVT + HNG RP KRRR
Sbjct: 69  AAAKSAMDQGMKHVEVSVKGPGAGREAAIRALQAAGLEITAIRDVTPVPHNGSRPPKRRR 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|261749447|ref|YP_003257133.1| 30S ribosomal protein S11 [Blattabacterium sp. (Periplaneta
           americana) str. BPLAN]
 gi|261497540|gb|ACX83990.1| 30S ribosomal protein S11 [Blattabacterium sp. (Periplaneta
           americana) str. BPLAN]
          Length = 128

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 83/121 (68%), Gaps = 3/121 (2%)

Query: 12  ERKNIVS---GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           ++K+IV    G AH+ STFNN  IT+T+  G  IAWSS   + F GS+KN+P+AAQ+A +
Sbjct: 8   KKKSIVVDSLGVAHIQSTFNNIIITLTNKKGEVIAWSSAGKMNFKGSKKNTPYAAQMAAE 67

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           + + +  N G+  +EVKV G GAGRD+A+RAL   G  +  I D+T + HNGCRP KRRR
Sbjct: 68  NVAKEGLNAGIKKVEVKVKGPGAGRDAAIRALSNSGIVVTLIKDITPLPHNGCRPPKRRR 127

Query: 129 I 129
           +
Sbjct: 128 V 128


>gi|326792580|ref|YP_004310401.1| 30S ribosomal protein S11 [Clostridium lentocellum DSM 5427]
 gi|326543344|gb|ADZ85203.1| 30S ribosomal protein S11 [Clostridium lentocellum DSM 5427]
          Length = 135

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + R+RK++  G AH+ STFNNT +T+TD +GN ++W+S   +GF GSRK++P+AAQ+A +
Sbjct: 15  KRRDRKHVERGVAHIQSTFNNTMVTLTDTNGNALSWASAGGLGFRGSRKSTPYAAQMAAE 74

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+ S+EV V G G+GR++A+RAL+A G  +  I DVT + HNGCRP KRRR
Sbjct: 75  TAAKAAMEHGLKSVEVMVKGPGSGREAAIRALQAAGLEVTLIKDVTPVPHNGCRPPKRRR 134

Query: 129 I 129
           +
Sbjct: 135 V 135


>gi|15605670|ref|NP_213045.1| 30S ribosomal protein S11 [Aquifex aeolicus VF5]
 gi|6226052|sp|O66485|RS11_AQUAE RecName: Full=30S ribosomal protein S11
 gi|2982821|gb|AAC06444.1| ribosomal protein S11 [Aquifex aeolicus VF5]
          Length = 125

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/108 (51%), Positives = 77/108 (71%)

Query: 22  HVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSS 81
           H+ +TFNNT + +TD  GNTIAW+S   VGF G+RK++P+AAQ+A      +A+ HG+  
Sbjct: 18  HIHTTFNNTIVNVTDTQGNTIAWASGGTVGFKGTRKSTPYAAQLAAQKAMKEAKEHGVQE 77

Query: 82  LEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +E+ V G GAGR+SA+RA+ A G  + +I DVT I HNGCRP  RRR+
Sbjct: 78  VEIWVKGPGAGRESAVRAVFASGVKVTAIRDVTPIPHNGCRPPARRRV 125


>gi|215400752|ref|YP_002327513.1| ribosomal protein S11 [Vaucheria litorea]
 gi|194441202|gb|ACF70930.1| ribosomal protein S11 [Vaucheria litorea]
          Length = 126

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/124 (46%), Positives = 84/124 (67%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
            + + + ++NI SG  H+ STFNNT IT+TD  GN++AW+S    GF G+RK + FAAQ+
Sbjct: 3   QKTKKKIKRNIPSGIVHIHSTFNNTIITVTDLKGNSVAWASAGTAGFKGTRKGTSFAAQL 62

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A    + +A + G+  ++V V G G GR++A+RAL+  G  IVSI D+T I +NGCRP  
Sbjct: 63  AAKKATLQAIDSGLKKVKVLVKGRGPGRETAIRALQTTGVKIVSIKDITPIPYNGCRPPN 122

Query: 126 RRRI 129
           RRR+
Sbjct: 123 RRRV 126


>gi|168187787|ref|ZP_02622422.1| ribosomal protein S11 [Clostridium botulinum C str. Eklund]
 gi|169294363|gb|EDS76496.1| ribosomal protein S11 [Clostridium botulinum C str. Eklund]
          Length = 131

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/115 (55%), Positives = 83/115 (72%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI  G AH+ STFNN+ +TITD  GN ++WSS   +GF GSRK++PFAAQ+A +  +  A
Sbjct: 17  NIEHGCAHIKSTFNNSIVTITDAVGNALSWSSAGALGFKGSRKSTPFAAQMAAETAANSA 76

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ S+EV V G GAGR++A+R+L+A G  I  I DVT I HNGCRP KRRR+
Sbjct: 77  MEHGLKSIEVYVKGPGAGREAAIRSLQAAGLEITLIKDVTPIPHNGCRPPKRRRV 131


>gi|313904925|ref|ZP_07838296.1| 30S ribosomal protein S11 [Eubacterium cellulosolvens 6]
 gi|313470182|gb|EFR65513.1| 30S ribosomal protein S11 [Eubacterium cellulosolvens 6]
          Length = 130

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 85/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G+AH+ ++FNNT +T+TD  GN ++W+S   +GF GSRK++P+AAQ+A +  +  A
Sbjct: 16  NVERGQAHIQASFNNTIVTLTDTEGNALSWASAGGLGFKGSRKSTPYAAQMAAETATKAA 75

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ S+EV V G G+GR++A+RAL A G  + SICDVT + HNGCRP KRRR+
Sbjct: 76  LVHGLKSVEVFVKGPGSGREAAIRALAAAGLEVTSICDVTPVPHNGCRPPKRRRV 130


>gi|222823137|ref|YP_002574710.1| 30S ribosomal protein S11 [Campylobacter lari RM2100]
 gi|254765373|sp|B9KEH4|RS11_CAMLR RecName: Full=30S ribosomal protein S11
 gi|222538358|gb|ACM63459.1| 30S ribosomal protein S11 [Campylobacter lari RM2100]
          Length = 130

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 83/116 (71%), Gaps = 1/116 (0%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI  G  ++ +TFNNT +T+TD  GN IAWSS   +GF GS+K++P+AAQ A +D   KA
Sbjct: 15  NIAKGIVYISATFNNTMVTVTDEMGNAIAWSSAGGLGFKGSKKSTPYAAQQAVEDALNKA 74

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAI-GFTIVSICDVTMIAHNGCRPRKRRRI 129
           + HG+  + +KV G G+GR++A++++ A+ G  +  + D+T +AHNGCRP KRRR+
Sbjct: 75  KEHGIKEVGIKVQGPGSGRETAVKSVGAMEGIKVTFLKDITPLAHNGCRPPKRRRV 130


>gi|296268579|ref|YP_003651211.1| 30S ribosomal protein S11 [Thermobispora bispora DSM 43833]
 gi|296091366|gb|ADG87318.1| ribosomal protein S11 [Thermobispora bispora DSM 43833]
          Length = 136

 Score =  121 bits (304), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 86/115 (74%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G AH+ STFNNT ++ITD +GN I+W+S   VGF GSRK++PFAAQ+A ++ + +A
Sbjct: 22  NVAHGHAHIKSTFNNTIVSITDTNGNVISWASAGHVGFKGSRKSTPFAAQMAAENAARRA 81

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HGM  ++V V G G+GR++A+RAL+A G  + SI DVT + HNGCRP KRRR+
Sbjct: 82  MEHGMRKVDVFVKGPGSGRETAIRALQATGLEVDSIQDVTPVPHNGCRPPKRRRV 136


>gi|28377857|ref|NP_784749.1| 30S ribosomal protein S11 [Lactobacillus plantarum WCFS1]
 gi|254556042|ref|YP_003062459.1| 30S ribosomal protein S11 [Lactobacillus plantarum JDM1]
 gi|300767845|ref|ZP_07077755.1| 30S ribosomal protein S11 [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|308180035|ref|YP_003924163.1| 30S ribosomal protein S11 [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|32171608|sp|Q88XW1|RS11_LACPL RecName: Full=30S ribosomal protein S11
 gi|28270690|emb|CAD63596.1| ribosomal protein S11 [Lactobacillus plantarum WCFS1]
 gi|254044969|gb|ACT61762.1| 30S ribosomal protein S11 [Lactobacillus plantarum JDM1]
 gi|300494830|gb|EFK29988.1| 30S ribosomal protein S11 [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|308045526|gb|ADN98069.1| 30S ribosomal protein S11 [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 129

 Score =  121 bits (304), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 63/115 (54%), Positives = 83/115 (72%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI SG AH+ STFNNT + ITD  GN IAWSS   +GF GSRK++PFAAQ+A +  +  +
Sbjct: 15  NIESGVAHIHSTFNNTLVMITDMQGNAIAWSSAGSLGFKGSRKSTPFAAQMAAEAAAKAS 74

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HGM ++EV V G G+GR++A+RAL+A G  + +I DVT + HNG RP KRRR+
Sbjct: 75  MEHGMKTVEVAVKGPGSGREAAIRALQATGLEVSAIRDVTPVPHNGSRPPKRRRV 129


>gi|310829558|ref|YP_003961915.1| 30S ribosomal protein S11 [Eubacterium limosum KIST612]
 gi|308741292|gb|ADO38952.1| 30S ribosomal protein S11 [Eubacterium limosum KIST612]
          Length = 130

 Score =  121 bits (304), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 63/115 (54%), Positives = 84/115 (73%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI  G+AH+ S+FNNT +TITD  GN ++W+S   +GF GSRK++PFAAQ+A +  +  A
Sbjct: 16  NIERGQAHIQSSFNNTIVTITDTAGNALSWASAGELGFRGSRKSTPFAAQMAAEQAAKLA 75

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ S+EV V G G+GR++A+RAL+A G  I  I DVT I HNGCRP KRRR+
Sbjct: 76  MEHGLKSVEVMVKGPGSGREAAIRALQAAGLEITLIRDVTPIPHNGCRPPKRRRV 130


>gi|119025364|ref|YP_909209.1| 30S ribosomal protein S11 [Bifidobacterium adolescentis ATCC 15703]
 gi|154486772|ref|ZP_02028179.1| hypothetical protein BIFADO_00597 [Bifidobacterium adolescentis
           L2-32]
 gi|212716587|ref|ZP_03324715.1| hypothetical protein BIFCAT_01516 [Bifidobacterium catenulatum DSM
           16992]
 gi|225351020|ref|ZP_03742043.1| hypothetical protein BIFPSEUDO_02602 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|152060577|sp|A1A094|RS11_BIFAA RecName: Full=30S ribosomal protein S11
 gi|118764948|dbj|BAF39127.1| 30S ribosomal protein S11 [Bifidobacterium adolescentis ATCC 15703]
 gi|154084635|gb|EDN83680.1| hypothetical protein BIFADO_00597 [Bifidobacterium adolescentis
           L2-32]
 gi|212660291|gb|EEB20866.1| hypothetical protein BIFCAT_01516 [Bifidobacterium catenulatum DSM
           16992]
 gi|225158476|gb|EEG71718.1| hypothetical protein BIFPSEUDO_02602 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 132

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 88/121 (72%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R R+RK++  G+AH+ STFNNT I+ITDP G  ++W+S   VGF GSRK++P+AA +A +
Sbjct: 12  RRRDRKSVPVGQAHIKSTFNNTIISITDPSGAVVSWASGGDVGFKGSRKSTPYAAGMAAE 71

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + KA  HG+  ++V V G G+GR++A+R+L++ G  + SI DVT  AHNG RP KRRR
Sbjct: 72  SAARKAMEHGLKKVDVFVKGPGSGRETAIRSLQSAGLEVGSITDVTPQAHNGVRPPKRRR 131

Query: 129 I 129
           +
Sbjct: 132 V 132


>gi|269837092|ref|YP_003319320.1| 30S ribosomal protein S11 [Sphaerobacter thermophilus DSM 20745]
 gi|269786355|gb|ACZ38498.1| ribosomal protein S11 [Sphaerobacter thermophilus DSM 20745]
          Length = 136

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 86/116 (74%)

Query: 14  KNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAK 73
           KNI  GRA++ STFNNT +T+TD  GN + W+S    GF GSRK++P+AAQVA ++ + K
Sbjct: 21  KNIPRGRAYIQSTFNNTIVTLTDQAGNVVGWASAGSSGFKGSRKSTPYAAQVAAENAARK 80

Query: 74  AQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           A +HGM  ++V + G GAGR+ A+R+L+A G  ++SI D+T + HNGCRP KRRR+
Sbjct: 81  AMDHGMRQVDVFIKGPGAGREMAIRSLQAAGMQVLSISDITPVPHNGCRPPKRRRV 136


>gi|257459218|ref|ZP_05624337.1| 30S ribosomal protein S11 [Campylobacter gracilis RM3268]
 gi|257443603|gb|EEV18727.1| 30S ribosomal protein S11 [Campylobacter gracilis RM3268]
          Length = 130

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 82/116 (70%), Gaps = 1/116 (0%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI  G  ++ +TFNNT IT+TD  GN IAWSS   + F GS+K++P+AAQ A +D  +KA
Sbjct: 15  NIAKGIVYISATFNNTMITVTDEMGNAIAWSSAGALNFKGSKKSTPYAAQQAVEDALSKA 74

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAI-GFTIVSICDVTMIAHNGCRPRKRRRI 129
           + HG+  + VKV G G+GR++A++++ ++ G  +    D+T +AHNGCRP KRRR+
Sbjct: 75  KEHGIKEVGVKVQGPGSGRETAVKSVGSVEGIKVTYFKDITPLAHNGCRPPKRRRV 130


>gi|38233156|ref|NP_938923.1| 30S ribosomal protein S11 [Corynebacterium diphtheriae NCTC 13129]
 gi|59798750|sp|Q6NJ65|RS11_CORDI RecName: Full=30S ribosomal protein S11
 gi|38199415|emb|CAE49058.1| 30S ribosomal protein S11 [Corynebacterium diphtheriae]
          Length = 134

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 86/117 (73%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KN+  G A++ STFNNT ++ITDP G  IAW+S   VGF GSRK++PFAAQ+A ++ + 
Sbjct: 18  KKNVAQGHAYIKSTFNNTIVSITDPSGAVIAWASSGHVGFKGSRKSTPFAAQLAAENAAR 77

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           KA +HGM  ++V V G G+GR++A+R+L+A G  + SI DVT    NGCRP KRRR+
Sbjct: 78  KAMDHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVTSISDVTPQPFNGCRPPKRRRV 134


>gi|326799153|ref|YP_004316972.1| 30S ribosomal protein S11 [Sphingobacterium sp. 21]
 gi|326549917|gb|ADZ78302.1| 30S ribosomal protein S11 [Sphingobacterium sp. 21]
          Length = 129

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 77/111 (69%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G+AH+ +TFNN  +T+T+  G TI+WSS   +GF GS+KN+P+AA  A  DC   A + G
Sbjct: 19  GQAHINATFNNIIVTLTNNQGQTISWSSAGKMGFKGSKKNTPYAASQAASDCGKVAHDLG 78

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +  +EV V G GAGR+SA+R L+  G  + SI D+T + HNGCRP KRRR+
Sbjct: 79  LRKVEVFVKGPGAGRESAIRTLQTQGIEVTSIKDITPLPHNGCRPPKRRRV 129


>gi|224283734|ref|ZP_03647056.1| 30S ribosomal protein S11 [Bifidobacterium bifidum NCIMB 41171]
 gi|311064872|ref|YP_003971598.1| 30S ribosomal protein S11P RpsK [Bifidobacterium bifidum PRL2010]
 gi|313140890|ref|ZP_07803083.1| 30S ribosomal protein S11 [Bifidobacterium bifidum NCIMB 41171]
 gi|310867192|gb|ADP36561.1| RpsK SSU ribosomal protein S11P [Bifidobacterium bifidum PRL2010]
 gi|313133400|gb|EFR51017.1| 30S ribosomal protein S11 [Bifidobacterium bifidum NCIMB 41171]
          Length = 132

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 92/129 (71%), Gaps = 1/129 (0%)

Query: 2   PKSPSR-IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           PK  +R  R R+RK+I  G+AH+ STFNNT I+ITDP G  ++W+S   VGF GSRK++P
Sbjct: 4   PKQAARKPRRRDRKSIPVGQAHIKSTFNNTIISITDPSGAVVSWASGGDVGFKGSRKSTP 63

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AA +A +  + KA  HG+  ++V V G G+GR++A+R+L++ G  + SI DVT  AHNG
Sbjct: 64  YAAGMAAESAARKAMEHGVKKVDVFVKGPGSGRETAIRSLQSAGLEVGSITDVTPQAHNG 123

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 124 VRPPKRRRV 132


>gi|303247016|ref|ZP_07333292.1| 30S ribosomal protein S11 [Desulfovibrio fructosovorans JJ]
 gi|302491723|gb|EFL51606.1| 30S ribosomal protein S11 [Desulfovibrio fructosovorans JJ]
          Length = 128

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 89/125 (71%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P RI  +ERKNI  G AH+ ++FNNT +T TD  GN ++W++    GF GSRK++PFAAQ
Sbjct: 4   PRRIGKKERKNIPVGVAHIQASFNNTIVTFTDQKGNVVSWATSGGAGFKGSRKSTPFAAQ 63

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           VA ++ + KAQ +GM ++ + V G G+GR++A+RA+   GF +  I D+T I HNGCRP 
Sbjct: 64  VAAENAARKAQENGMRTVGILVKGPGSGREAAMRAIHNAGFKVSYIRDITPIPHNGCRPP 123

Query: 125 KRRRI 129
           KRRR+
Sbjct: 124 KRRRV 128


>gi|291518021|emb|CBK73242.1| SSU ribosomal protein S11P [Butyrivibrio fibrisolvens 16/4]
          Length = 130

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 56/115 (48%), Positives = 83/115 (72%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G+ HV ++FNNT +TITD  GN ++W+S   +GF GSRK++P+AAQ+A +     A
Sbjct: 16  NVEHGQVHVQASFNNTIVTITDAQGNALSWASAGGLGFRGSRKSTPYAAQMAAETAVKAA 75

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ S++V V G G+GR++A+RA+ A G  +++I DVT + HNGCRP KRRR+
Sbjct: 76  LVHGLKSVDVFVKGPGSGREAAIRAIDANGVQVLTIKDVTPVPHNGCRPPKRRRV 130


>gi|15835409|ref|NP_297168.1| 30S ribosomal protein S11 [Chlamydia muridarum Nigg]
 gi|270285589|ref|ZP_06194983.1| 30S ribosomal protein S11 [Chlamydia muridarum Nigg]
 gi|270289599|ref|ZP_06195901.1| 30S ribosomal protein S11 [Chlamydia muridarum Weiss]
 gi|301336985|ref|ZP_07225187.1| 30S ribosomal protein S11 [Chlamydia muridarum MopnTet14]
 gi|14195203|sp|Q9PJN3|RS11_CHLMU RecName: Full=30S ribosomal protein S11
 gi|7190823|gb|AAF39598.1| ribosomal protein S11 [Chlamydia muridarum Nigg]
          Length = 132

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 86/122 (70%)

Query: 8   IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
           ++ ++ KNI SG  HV +TFNNT +TITDP GN I+W+S   VG+SGSRK+S FAA VA 
Sbjct: 11  VKRKQVKNIPSGVVHVKATFNNTIVTITDPAGNVISWASAGKVGYSGSRKSSAFAATVAA 70

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
            D +  A + G+  +EV + G GAGR+SA+RAL + G  +  I D T + HNGCRPRKRR
Sbjct: 71  QDAAKTAMSSGLKEVEVSLKGTGAGRESAVRALISSGLIVSVIRDETPVPHNGCRPRKRR 130

Query: 128 RI 129
           R+
Sbjct: 131 RV 132


>gi|300857807|ref|YP_003782790.1| 30S ribosomal protein S11 [Corynebacterium pseudotuberculosis
           FRC41]
 gi|300685261|gb|ADK28183.1| 30S ribosomal protein S11 [Corynebacterium pseudotuberculosis
           FRC41]
 gi|302205542|gb|ADL09884.1| 30S ribosomal protein S11 [Corynebacterium pseudotuberculosis C231]
 gi|302330097|gb|ADL20291.1| 30S ribosomal protein S11 [Corynebacterium pseudotuberculosis 1002]
 gi|308275778|gb|ADO25677.1| 30S ribosomal protein S11 [Corynebacterium pseudotuberculosis I19]
          Length = 134

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 86/117 (73%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KN+  G A++ STFNNT ++ITDP G  IAW+S   VGF GSRK++PFAAQ+A ++ + 
Sbjct: 18  KKNVAQGHAYIKSTFNNTIVSITDPSGAVIAWASSGHVGFKGSRKSTPFAAQLAAENAAR 77

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           KA +HGM  ++V V G G+GR++A+R+L+A G  + SI DVT    NGCRP KRRR+
Sbjct: 78  KAMDHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVTSISDVTPQPFNGCRPPKRRRV 134


>gi|297567258|ref|YP_003686230.1| 30S ribosomal protein S11 [Meiothermus silvanus DSM 9946]
 gi|296851707|gb|ADH64722.1| 30S ribosomal protein S11 [Meiothermus silvanus DSM 9946]
          Length = 132

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 83/114 (72%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
            +  GRA + +++NNT +TITDP GN + WSS  V+G+ GSRK +P+AAQ+A  D + KA
Sbjct: 16  QVSGGRAFIHASYNNTIVTITDPDGNPVTWSSGGVIGYKGSRKGTPYAAQLAAMDAAKKA 75

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           QN GM+S+EV V G GAGR+ A+RAL+A G  + SI D T + HNGCRPRK+ R
Sbjct: 76  QNFGMTSVEVVVRGTGAGREQAIRALQASGLQVRSIVDDTPVPHNGCRPRKKFR 129


>gi|145219086|ref|YP_001129795.1| 30S ribosomal protein S11 [Prosthecochloris vibrioformis DSM 265]
 gi|189040426|sp|A4SCT4|RS11_PROVI RecName: Full=30S ribosomal protein S11
 gi|145205250|gb|ABP36293.1| SSU ribosomal protein S11P [Chlorobium phaeovibrioides DSM 265]
          Length = 127

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 80/112 (71%)

Query: 18  SGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNH 77
            G  H+ ++FNN  ITITD  GNT++WSS    GF GS+KN+P+A+QV ++  + +A + 
Sbjct: 16  EGAVHIKASFNNIMITITDVQGNTVSWSSAGKNGFRGSKKNTPYASQVTSEAAAKEAYDL 75

Query: 78  GMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           GM  ++V + G GAGRD+A+RAL+ +G  + +I D+T + HNGCRP KRRR+
Sbjct: 76  GMRHVDVFIKGPGAGRDAAIRALQGVGLEVRTIKDITPLPHNGCRPPKRRRV 127


>gi|283782778|ref|YP_003373532.1| 30S ribosomal protein S11 [Gardnerella vaginalis 409-05]
 gi|297242945|ref|ZP_06926883.1| ribosomal protein S11 [Gardnerella vaginalis AMD]
 gi|308235470|ref|ZP_07666207.1| 30S ribosomal protein S11 [Gardnerella vaginalis ATCC 14018]
 gi|311115143|ref|YP_003986364.1| 30S ribosomal protein S11 [Gardnerella vaginalis ATCC 14019]
 gi|283441833|gb|ADB14299.1| 30S ribosomal protein S11 [Gardnerella vaginalis 409-05]
 gi|296889156|gb|EFH27890.1| ribosomal protein S11 [Gardnerella vaginalis AMD]
 gi|310946637|gb|ADP39341.1| 30S ribosomal protein S11 [Gardnerella vaginalis ATCC 14019]
          Length = 132

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 88/121 (72%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R R+RK++  G+AH+ STFNNT I+ITDP G  ++W+S   VGF GSRK++P+AA +A +
Sbjct: 12  RRRDRKSVPVGQAHIKSTFNNTIISITDPSGAVLSWASGGDVGFKGSRKSTPYAAGMAAE 71

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + KA  HG+  ++V V G G+GR++A+R+L++ G  + SI DVT  AHNG RP KRRR
Sbjct: 72  SAARKAMEHGLKKVDVFVKGPGSGRETAIRSLQSAGLEVGSITDVTPQAHNGVRPPKRRR 131

Query: 129 I 129
           +
Sbjct: 132 V 132


>gi|254495365|ref|ZP_05108289.1| 30S ribosomal protein S11 [Polaribacter sp. MED152]
 gi|85819719|gb|EAQ40876.1| 30S ribosomal protein S11 [Polaribacter sp. MED152]
          Length = 127

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 84/121 (69%), Gaps = 2/121 (1%)

Query: 11  RERKNIVS--GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           ++RK I+   G AHV +TFNN  I++T+  G+ I+WSS   +GF GS+KN+P+AAQ+A +
Sbjct: 7   KKRKVIIDAIGEAHVSATFNNIIISLTNKKGDVISWSSAGKMGFRGSKKNTPYAAQLAAE 66

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           DC+  A+  G+  ++V V G G GR+SA+R++   G  +  I DVT I HNGCRP KRRR
Sbjct: 67  DCANVAKEAGLRKVKVYVKGPGNGRESAIRSIHNAGIEVTEIIDVTPIPHNGCRPPKRRR 126

Query: 129 I 129
           +
Sbjct: 127 V 127


>gi|305665113|ref|YP_003861400.1| 30S ribosomal protein S11 [Maribacter sp. HTCC2170]
 gi|88709865|gb|EAR02097.1| 30S ribosomal protein S11 [Maribacter sp. HTCC2170]
          Length = 130

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/121 (48%), Positives = 82/121 (67%), Gaps = 2/121 (1%)

Query: 11  RERKNIVS--GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           ++RK IV   G AHV ++FNN  I++T+  G+ I+WSS    GF GS+KN+P+AAQVA +
Sbjct: 10  KKRKVIVDAVGEAHVTASFNNIIISLTNKKGDVISWSSAGKQGFRGSKKNTPYAAQVAAE 69

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           DC+  A   G+  ++V V G G GR+SA+R+L   G  +  I DVT + HNGCRP KRRR
Sbjct: 70  DCAKVAHEAGLRKVKVYVKGPGNGRESAIRSLHNAGIEVTEIIDVTPMPHNGCRPPKRRR 129

Query: 129 I 129
           +
Sbjct: 130 V 130


>gi|126662240|ref|ZP_01733239.1| 30S ribosomal protein S11 [Flavobacteria bacterium BAL38]
 gi|126625619|gb|EAZ96308.1| 30S ribosomal protein S11 [Flavobacteria bacterium BAL38]
          Length = 127

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/121 (48%), Positives = 83/121 (68%), Gaps = 2/121 (1%)

Query: 11  RERKNIV--SGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           ++RK IV  SG AH+ +TFNN  I++T+  G  I+WSS   +GF GS+KN+P+AAQ+A +
Sbjct: 7   KKRKVIVESSGEAHINATFNNIIISLTNKKGEVISWSSAGKMGFRGSKKNTPYAAQMAAE 66

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           DCS  A   G+  ++V V G G GR+SA+R++   G  +  I DVT + HNGCRP KRRR
Sbjct: 67  DCSKVALEAGLKKVKVYVKGPGNGRESAIRSIHNSGVEVTEIIDVTPMPHNGCRPPKRRR 126

Query: 129 I 129
           +
Sbjct: 127 V 127


>gi|224373705|ref|YP_002608077.1| 30S ribosomal protein S11 [Nautilia profundicola AmH]
 gi|254811036|sp|B9L6T9|RS11_NAUPA RecName: Full=30S ribosomal protein S11
 gi|223588779|gb|ACM92515.1| ribosomal protein S11 [Nautilia profundicola AmH]
          Length = 130

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 80/112 (71%), Gaps = 1/112 (0%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G  ++ +TFNNT IT+TD  GN + WSS   +GF GS+K++PFAAQ A +D  AKA+ +G
Sbjct: 19  GVVYISATFNNTMITVTDEMGNALCWSSAGALGFKGSKKSTPFAAQQAVEDVMAKAKEYG 78

Query: 79  MSSLEVKVSGLGAGRDSALRALRAI-GFTIVSICDVTMIAHNGCRPRKRRRI 129
           +  + +KV G G GR++A++ + AI G  ++ + DVT + HNGCRPRKRRR+
Sbjct: 79  IKEVGIKVQGPGGGRETAVKTVGAIEGIKVLWMKDVTPLPHNGCRPRKRRRV 130


>gi|95930498|ref|ZP_01313234.1| ribosomal protein S11 [Desulfuromonas acetoxidans DSM 684]
 gi|95133538|gb|EAT15201.1| ribosomal protein S11 [Desulfuromonas acetoxidans DSM 684]
          Length = 131

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           +++ +KNIV+G AH+ +TFNNT ++I D  GN I+W++    GF GSRK++PFAAQVA +
Sbjct: 11  KSKAKKNIVNGVAHIQATFNNTIVSIADVSGNVISWATAGGSGFKGSRKSTPFAAQVAAE 70

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  AQ HG+ ++EV V G G+GR+SALRAL++ G  +  I DVT I HNGCRP KRRR
Sbjct: 71  TAAKAAQEHGLRNVEVCVKGPGSGRESALRALQSAGLNVTMIKDVTPIPHNGCRPPKRRR 130

Query: 129 I 129
           +
Sbjct: 131 V 131


>gi|258543842|ref|ZP_05704076.1| 30S ribosomal protein S11 [Cardiobacterium hominis ATCC 15826]
 gi|258520931|gb|EEV89790.1| 30S ribosomal protein S11 [Cardiobacterium hominis ATCC 15826]
          Length = 132

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 87/122 (71%)

Query: 8   IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
           +R + ++ +V   AHV ++FNNT +TITD  GNT++W++    GF GSRK++PFAAQVA 
Sbjct: 11  VRKKAKRVVVDAVAHVHASFNNTIVTITDGQGNTLSWATAGGSGFRGSRKSTPFAAQVAA 70

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
           +     A+  G+ +L+V + G G GR+SA+RAL A+GF I SI DVT I HNGCRP K+R
Sbjct: 71  ERAGNAAKEFGVQNLDVNIKGPGPGRESAVRALNAVGFNIHSITDVTPIPHNGCRPPKKR 130

Query: 128 RI 129
           R+
Sbjct: 131 RV 132


>gi|78776526|ref|YP_392841.1| 30S ribosomal protein S11 [Sulfurimonas denitrificans DSM 1251]
 gi|91207686|sp|Q30TS5|RS11_SULDN RecName: Full=30S ribosomal protein S11
 gi|78497066|gb|ABB43606.1| SSU ribosomal protein S11P [Sulfurimonas denitrificans DSM 1251]
          Length = 130

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 80/116 (68%), Gaps = 1/116 (0%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI  G  H+ ++FNNT +TITD  GN IAWSS   +GF GS+K++PFAAQ A +D  AKA
Sbjct: 15  NIARGICHISASFNNTLVTITDEMGNMIAWSSAGSLGFKGSKKSTPFAAQAAVEDAVAKA 74

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAI-GFTIVSICDVTMIAHNGCRPRKRRRI 129
           Q HG+  L +KV G G+GR++A +A+  I G  +  + DVT + HNGCR  KRRR+
Sbjct: 75  QVHGVKELGIKVQGPGSGRETATKAVGGIEGIRVTFMKDVTPLPHNGCRAPKRRRV 130


>gi|290968217|ref|ZP_06559760.1| 30S ribosomal protein S11 [Megasphaera genomosp. type_1 str. 28L]
 gi|312899070|ref|ZP_07758454.1| 30S ribosomal protein S11 [Megasphaera micronuciformis F0359]
 gi|290781699|gb|EFD94284.1| 30S ribosomal protein S11 [Megasphaera genomosp. type_1 str. 28L]
 gi|310619855|gb|EFQ03431.1| 30S ribosomal protein S11 [Megasphaera micronuciformis F0359]
          Length = 130

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 89/121 (73%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + +E+K++ SG AH+ STFNNT +TI+D  GN ++W+S   +GF GSRK++PFAAQ+A +
Sbjct: 10  KRKEKKHVESGAAHIRSTFNNTIVTISDTKGNALSWASAGGLGFRGSRKSTPFAAQMAAE 69

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             +  A  HG+  +EV V G G+GR++A+RAL+A G  + SI DVT I HNGCRP KRRR
Sbjct: 70  QAAKAAMEHGLRQVEVFVKGPGSGREAAIRALQAAGLEVNSIKDVTPIPHNGCRPPKRRR 129

Query: 129 I 129
           +
Sbjct: 130 V 130


>gi|291280123|ref|YP_003496958.1| 30S ribosomal protein S11 [Deferribacter desulfuricans SSM1]
 gi|290754825|dbj|BAI81202.1| 30S ribosomal protein S11 [Deferribacter desulfuricans SSM1]
          Length = 126

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 85/121 (70%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +E++NI  G AH+ STFNNT IT TD +GN I W S    GF  +RK++P+AAQ+A +
Sbjct: 6   RKKEKRNIPKGIAHIKSTFNNTIITFTDVNGNVICWDSSGTAGFKNARKSTPYAAQLAAE 65

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + KA  +G+  +EV V G GAGR+SA+RA++A G  I  I DVT I HNGCRPRK+RR
Sbjct: 66  SAAKKAVENGVREVEVNVKGPGAGRESAIRAIQAAGIKITVIRDVTPIPHNGCRPRKKRR 125

Query: 129 I 129
           +
Sbjct: 126 V 126


>gi|171741249|ref|ZP_02917056.1| hypothetical protein BIFDEN_00324 [Bifidobacterium dentium ATCC
           27678]
 gi|229818215|ref|ZP_04448497.1| hypothetical protein BIFANG_03513 [Bifidobacterium angulatum DSM
           20098]
 gi|283455391|ref|YP_003359955.1| 30S ribosomal protein S11P [Bifidobacterium dentium Bd1]
 gi|306823543|ref|ZP_07456918.1| 30S ribosomal protein S11 [Bifidobacterium dentium ATCC 27679]
 gi|309803014|ref|ZP_07697115.1| 30S ribosomal protein S11 [Bifidobacterium dentium JCVIHMP022]
 gi|171276863|gb|EDT44524.1| hypothetical protein BIFDEN_00324 [Bifidobacterium dentium ATCC
           27678]
 gi|229784466|gb|EEP20580.1| hypothetical protein BIFANG_03513 [Bifidobacterium angulatum DSM
           20098]
 gi|283102025|gb|ADB09131.1| rpsK SSU ribosomal protein S11P [Bifidobacterium dentium Bd1]
 gi|304553250|gb|EFM41162.1| 30S ribosomal protein S11 [Bifidobacterium dentium ATCC 27679]
 gi|308220481|gb|EFO76792.1| 30S ribosomal protein S11 [Bifidobacterium dentium JCVIHMP022]
          Length = 132

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 88/121 (72%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R R+RK++  G+AH+ STFNNT I+ITDP G  ++W+S   VGF GSRK++P+AA +A +
Sbjct: 12  RRRDRKSVPVGQAHIKSTFNNTIISITDPSGAVVSWASGGDVGFKGSRKSTPYAAGMAAE 71

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + KA  HG+  ++V V G G+GR++A+R+L++ G  + SI DVT  AHNG RP KRRR
Sbjct: 72  SAARKAMEHGVKKVDVFVKGPGSGRETAIRSLQSAGLEVGSITDVTPQAHNGVRPPKRRR 131

Query: 129 I 129
           +
Sbjct: 132 V 132


>gi|327402759|ref|YP_004343597.1| 30S ribosomal protein S11P [Fluviicola taffensis DSM 16823]
 gi|327318267|gb|AEA42759.1| SSU ribosomal protein S11P [Fluviicola taffensis DSM 16823]
          Length = 128

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 79/112 (70%)

Query: 18  SGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNH 77
           +G AH+ +TFNN  I++T+  G  I+WSS   +GF GS+KN+P+AAQVA +D S +A + 
Sbjct: 17  AGEAHIQATFNNVIISLTNNAGQVISWSSAGKMGFKGSKKNTPYAAQVAAEDASKEAHDF 76

Query: 78  GMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           G+  + V V G GAGR+SA+RA+   G  ++ I DVT + HNGCRP KRRR+
Sbjct: 77  GLRRVRVFVKGPGAGRESAIRAIHNHGIEVIEIIDVTPLPHNGCRPPKRRRV 128


>gi|307694125|ref|ZP_07636362.1| 30S ribosomal protein S11 [Ruminococcaceae bacterium D16]
          Length = 134

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 88/122 (72%), Gaps = 1/122 (0%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + RERKN+  G+ H+ S+FNNT +T+TD  GN ++W+S   +GF GSRK++PFAAQ A +
Sbjct: 13  KRRERKNVEKGQVHIRSSFNNTMVTVTDMQGNALSWASSGGLGFRGSRKSTPFAAQTAAE 72

Query: 69  DCSAKA-QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
             +  A + +G+  +EV V G GAGR++A+RAL+A+G  +  I DVT + HNGCRP KRR
Sbjct: 73  TAAKAAMEGYGLKIVEVYVKGPGAGREAAIRALQAVGLEVTLIKDVTPVPHNGCRPPKRR 132

Query: 128 RI 129
           R+
Sbjct: 133 RV 134


>gi|227538694|ref|ZP_03968743.1| ribosomal protein S11 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300770227|ref|ZP_07080106.1| 30S ribosomal protein S11 [Sphingobacterium spiritivorum ATCC
           33861]
 gi|227241613|gb|EEI91628.1| ribosomal protein S11 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300762703|gb|EFK59520.1| 30S ribosomal protein S11 [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 129

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 78/111 (70%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G+AH+ +TFNN  +T+T+  G TI+WSS   +GF GS+KN+P+AA  A  DC   A + G
Sbjct: 19  GQAHINATFNNIIVTLTNNQGQTISWSSAGKMGFRGSKKNTPYAASQAASDCGKVAHDLG 78

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +  +EV V G GAGR+SA+R L+ +G  + +I D+T + HNGCRP KRRR+
Sbjct: 79  LRKVEVFVKGPGAGRESAIRTLQTVGIDVTTIKDITPLPHNGCRPPKRRRV 129


>gi|23336306|ref|ZP_00121529.1| COG0100: Ribosomal protein S11 [Bifidobacterium longum DJO10A]
 gi|58036265|ref|YP_190223.1| 30S ribosomal protein S11 [Bifidobacterium longum NCC2705]
 gi|189440594|ref|YP_001955675.1| 30S ribosomal protein S11 [Bifidobacterium longum DJO10A]
 gi|213693063|ref|YP_002323649.1| ribosomal protein S11 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|227546501|ref|ZP_03976550.1| ribosomal protein S11 [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|239621035|ref|ZP_04664066.1| 30S ribosomal protein S11 [Bifidobacterium longum subsp. infantis
           CCUG 52486]
 gi|291457228|ref|ZP_06596618.1| 30S ribosomal protein S11 [Bifidobacterium breve DSM 20213]
 gi|296454845|ref|YP_003661989.1| 30S ribosomal protein S11 [Bifidobacterium longum subsp. longum
           JDM301]
 gi|312133899|ref|YP_004001238.1| rpsk [Bifidobacterium longum subsp. longum BBMN68]
 gi|317483425|ref|ZP_07942415.1| 30S ribosomal protein S11 [Bifidobacterium sp. 12_1_47BFAA]
 gi|322689904|ref|YP_004209638.1| 30S ribosomal protein S11 [Bifidobacterium longum subsp. infantis
           157F]
 gi|322691845|ref|YP_004221415.1| 30S ribosomal protein S11 [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|62287363|sp|Q5KQA1|RS11_BIFLO RecName: Full=30S ribosomal protein S11
 gi|226708333|sp|B3DQD9|RS11_BIFLD RecName: Full=30S ribosomal protein S11
 gi|254765368|sp|B7GNB5|RS11_BIFLI RecName: Full=30S ribosomal protein S11
 gi|57902626|gb|AAW58056.1| ribosomal protein S11 [Bifidobacterium longum NCC2705]
 gi|189429029|gb|ACD99177.1| Ribosomal protein S11 [Bifidobacterium longum DJO10A]
 gi|213524524|gb|ACJ53271.1| ribosomal protein S11 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|227213050|gb|EEI80929.1| ribosomal protein S11 [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|239516136|gb|EEQ56003.1| 30S ribosomal protein S11 [Bifidobacterium longum subsp. infantis
           CCUG 52486]
 gi|291381063|gb|EFE88581.1| 30S ribosomal protein S11 [Bifidobacterium breve DSM 20213]
 gi|291516446|emb|CBK70062.1| SSU ribosomal protein S11P [Bifidobacterium longum subsp. longum
           F8]
 gi|296184277|gb|ADH01159.1| ribosomal protein S11 [Bifidobacterium longum subsp. longum JDM301]
 gi|311773193|gb|ADQ02681.1| RpsK [Bifidobacterium longum subsp. longum BBMN68]
 gi|316915111|gb|EFV36543.1| 30S ribosomal protein S11 [Bifidobacterium sp. 12_1_47BFAA]
 gi|320456701|dbj|BAJ67323.1| 30S ribosomal protein S11 [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|320459241|dbj|BAJ69862.1| 30S ribosomal protein S11 [Bifidobacterium longum subsp. infantis
           ATCC 15697]
 gi|320461240|dbj|BAJ71860.1| 30S ribosomal protein S11 [Bifidobacterium longum subsp. infantis
           157F]
          Length = 132

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 64/129 (49%), Positives = 92/129 (71%), Gaps = 1/129 (0%)

Query: 2   PKSPSR-IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           PK  +R  R R+RK++  G+AH+ STFNNT I+ITDP G  ++W+S   VGF GSRK++P
Sbjct: 4   PKQAARKPRRRDRKSVPVGQAHIKSTFNNTIISITDPSGAVVSWASGGDVGFKGSRKSTP 63

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AA +A +  + KA  HG+  ++V V G G+GR++A+R+L++ G  + SI DVT  AHNG
Sbjct: 64  YAAGMAAESAARKAMEHGVKKVDVFVKGPGSGRETAIRSLQSAGLEVGSITDVTPQAHNG 123

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 124 VRPPKRRRV 132


>gi|283953795|ref|ZP_06371326.1| 30S ribosomal protein S11 [Campylobacter jejuni subsp. jejuni 414]
 gi|283794836|gb|EFC33574.1| 30S ribosomal protein S11 [Campylobacter jejuni subsp. jejuni 414]
          Length = 130

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 82/112 (73%), Gaps = 1/112 (0%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G  ++ +TFNNT +T+TD  GNTIAWSS   +GF GS+K++P+AAQ A +D   KA+ HG
Sbjct: 19  GIVYISATFNNTMVTVTDEMGNTIAWSSAGGLGFKGSKKSTPYAAQQAVEDALNKAKEHG 78

Query: 79  MSSLEVKVSGLGAGRDSALRALRAI-GFTIVSICDVTMIAHNGCRPRKRRRI 129
           +  + +KV G G+GR++A++++ AI G  +  + D+T +AHNGCRP KRRR+
Sbjct: 79  IKEVGIKVQGPGSGRETAVKSVGAIEGIKVTFLKDITPLAHNGCRPPKRRRV 130


>gi|298345436|ref|YP_003718123.1| 30S ribosomal protein S11 [Mobiluncus curtisii ATCC 43063]
 gi|304390992|ref|ZP_07372944.1| 30S ribosomal protein S11 [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|315656232|ref|ZP_07909123.1| 30S ribosomal protein S11 [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
 gi|298235497|gb|ADI66629.1| 30S ribosomal protein S11 [Mobiluncus curtisii ATCC 43063]
 gi|304325875|gb|EFL93121.1| 30S ribosomal protein S11 [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|315493234|gb|EFU82834.1| 30S ribosomal protein S11 [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
          Length = 131

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 89/124 (71%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           ++ R +ER+N+  G A++ STFNNT ++ITDP G  +AWSS   VGF GSRK++PFAAQ+
Sbjct: 8   TKSRRKERRNVTEGNAYIKSTFNNTIVSITDPSGAVLAWSSSGQVGFKGSRKSTPFAAQL 67

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  + +AQ  G+  ++V V G G+GR++A+R L A G  + SI DVT  AHNGCRP K
Sbjct: 68  AAEAAARRAQEFGLKKVDVFVKGPGSGRETAIRTLTATGLEVGSIQDVTPQAHNGCRPPK 127

Query: 126 RRRI 129
           RRR+
Sbjct: 128 RRRV 131


>gi|21674973|ref|NP_663038.1| 30S ribosomal protein S11 [Chlorobium tepidum TLS]
 gi|47606465|sp|Q8KAJ6|RS11_CHLTE RecName: Full=30S ribosomal protein S11
 gi|21648205|gb|AAM73380.1| ribosomal protein S11 [Chlorobium tepidum TLS]
          Length = 127

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 80/112 (71%)

Query: 18  SGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNH 77
            G  H+ ++FNN  +TITD  GNT++WSS    GF GS+KN+P+A+QV ++  + +A + 
Sbjct: 16  EGTVHIKASFNNVMVTITDTLGNTVSWSSAGKNGFKGSKKNTPYASQVTSEAAAKEAYDL 75

Query: 78  GMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           GM  ++V + G G+GRD+A+RAL+ +G  + SI D+T + HNGCRP KRRR+
Sbjct: 76  GMRYVDVLIKGPGSGRDAAIRALQGVGLEVRSIRDITPLPHNGCRPPKRRRV 127


>gi|257069481|ref|YP_003155736.1| 30S ribosomal protein S11P [Brachybacterium faecium DSM 4810]
 gi|256560299|gb|ACU86146.1| SSU ribosomal protein S11P [Brachybacterium faecium DSM 4810]
          Length = 134

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 90/121 (74%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           R +++KNIV+G+AH+ STFNNT ++ITDP G  I+W+S   VGF GSRK++P+AAQ+A +
Sbjct: 14  RRKDKKNIVNGQAHIKSTFNNTIVSITDPTGAVISWASAGQVGFKGSRKSTPYAAQMAAE 73

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
             + +AQ HG+  ++V V G G+GR++A+R+L A G  + SI DVT   HNG RP KRRR
Sbjct: 74  AAARQAQEHGLKKVDVFVKGPGSGRETAIRSLTATGLEVGSIQDVTPQPHNGTRPAKRRR 133

Query: 129 I 129
           +
Sbjct: 134 V 134


>gi|124112111|ref|YP_001019082.1| ribosomal protein S11 [Chlorokybus atmophyticus]
 gi|152060516|sp|Q19VB6|RR11_CHLAT RecName: Full=30S ribosomal protein S11, chloroplastic
 gi|124012220|gb|ABD62243.2| ribosomal protein S11 [Chlorokybus atmophyticus]
          Length = 130

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 80/122 (65%), Gaps = 1/122 (0%)

Query: 8   IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
           IR  +RK I  G  HV +TFNNT +TITD  G  I+WSS    GF G++K +PFAAQ A 
Sbjct: 10  IRKGKRK-IPKGVVHVQATFNNTIVTITDIKGEVISWSSAGSCGFKGTKKGTPFAAQTAA 68

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
           ++   +A   GM   E+ VSG G+GR++A+RA+R  G  I  + DVT I HNGCRP K+R
Sbjct: 69  ENAVRQAIEQGMKEAEITVSGPGSGRETAIRAIRTAGLGITVLKDVTPIPHNGCRPPKKR 128

Query: 128 RI 129
           R+
Sbjct: 129 RV 130


>gi|312880345|ref|ZP_07740145.1| SSU ribosomal protein S11P [Aminomonas paucivorans DSM 12260]
 gi|310783636|gb|EFQ24034.1| SSU ribosomal protein S11P [Aminomonas paucivorans DSM 12260]
          Length = 130

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 61/123 (49%), Positives = 87/123 (70%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           R + +E+K+I  G AHV STFNNT +T+TD  GN ++W+S   VGF G+RK++P+AAQ++
Sbjct: 8   RSKRKEKKHISYGVAHVYSTFNNTIVTLTDKQGNALSWASGGNVGFKGTRKSTPYAAQMS 67

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
               +  AQ+HG+  ++V V G G GR+SA+R+L+A G  +  I D T I HNGCRP KR
Sbjct: 68  AAQAAKVAQDHGVVEIDVVVKGPGPGRESAIRSLQAAGLQVNLIKDATPIPHNGCRPPKR 127

Query: 127 RRI 129
           RR+
Sbjct: 128 RRV 130


>gi|149195170|ref|ZP_01872261.1| 30S ribosomal protein S11 [Caminibacter mediatlanticus TB-2]
 gi|149134722|gb|EDM23207.1| 30S ribosomal protein S11 [Caminibacter mediatlanticus TB-2]
          Length = 130

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 80/112 (71%), Gaps = 1/112 (0%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G  ++ +TFNNT IT+TD  GN + WSS   +GF GS+K++PFAAQ A +D  AKA+ +G
Sbjct: 19  GIVYISATFNNTMITVTDEMGNALCWSSAGALGFKGSKKSTPFAAQQAVEDVMAKAKEYG 78

Query: 79  MSSLEVKVSGLGAGRDSALRALRAI-GFTIVSICDVTMIAHNGCRPRKRRRI 129
           +  + +KV G G GR++A++ + AI G  ++ + DVT + HNGCRPRKRRR+
Sbjct: 79  IKEVGIKVQGPGGGRETAVKTVGAIDGIKVLWMKDVTPLPHNGCRPRKRRRV 130


>gi|172040039|ref|YP_001799753.1| 30S ribosomal protein S11 [Corynebacterium urealyticum DSM 7109]
 gi|259494618|sp|B1VEY0|RS11_CORU7 RecName: Full=30S ribosomal protein S11
 gi|171851343|emb|CAQ04319.1| 30S ribosomal protein S11 [Corynebacterium urealyticum DSM 7109]
          Length = 135

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 84/117 (71%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KN+  G A++ STFNNT ++ITDP G+ I+W+S   VGF GSRK++PFAAQ+A +  + 
Sbjct: 19  KKNVTQGHAYIKSTFNNTIVSITDPKGHVISWASSGQVGFKGSRKSTPFAAQLAAESAAR 78

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           KA  HGM  ++V V G G+GR++A+R+L   G  + +I DVT   HNGCRP KRRR+
Sbjct: 79  KAMEHGMKKVDVFVKGPGSGRETAIRSLSTAGLEVGTIADVTPQPHNGCRPPKRRRV 135


>gi|320533220|ref|ZP_08033934.1| 30S ribosomal protein S11 [Actinomyces sp. oral taxon 171 str.
           F0337]
 gi|320134570|gb|EFW26804.1| 30S ribosomal protein S11 [Actinomyces sp. oral taxon 171 str.
           F0337]
          Length = 133

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 89/123 (72%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           + R ++RKN+  G A++ STFNNT +++TDP G  IAW S   VGF GSRK++P+AAQ+A
Sbjct: 11  KTRRKDRKNVTHGHAYIKSTFNNTIVSLTDPQGAVIAWCSSGQVGFKGSRKSTPYAAQLA 70

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +AQ HGM  ++V V G G+GR++A+R+L+A G  + SI DVT  A NGCRP KR
Sbjct: 71  AEAAARRAQEHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVGSITDVTPQAFNGCRPPKR 130

Query: 127 RRI 129
           RR+
Sbjct: 131 RRV 133


>gi|325068058|ref|ZP_08126731.1| ribosomal protein S11 [Actinomyces oris K20]
 gi|326773989|ref|ZP_08233271.1| 30S ribosomal protein S11 [Actinomyces viscosus C505]
 gi|326636128|gb|EGE37032.1| 30S ribosomal protein S11 [Actinomyces viscosus C505]
          Length = 133

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 89/123 (72%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           + R ++RKN+  G A++ STFNNT +++TDP G  IAW S   VGF GSRK++P+AAQ+A
Sbjct: 11  KTRRKDRKNVTHGHAYIKSTFNNTIVSLTDPQGAVIAWCSSGQVGFKGSRKSTPYAAQLA 70

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +AQ HGM  ++V V G G+GR++A+R+L+A G  + SI DVT  A NGCRP KR
Sbjct: 71  AEAAARRAQEHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVGSITDVTPQAFNGCRPPKR 130

Query: 127 RRI 129
           RR+
Sbjct: 131 RRV 133


>gi|319955880|ref|YP_004167143.1| SSU ribosomal protein s11p [Nitratifractor salsuginis DSM 16511]
 gi|319418284|gb|ADV45394.1| SSU ribosomal protein S11P [Nitratifractor salsuginis DSM 16511]
          Length = 124

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 52/122 (42%), Positives = 86/122 (70%), Gaps = 1/122 (0%)

Query: 9   RNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           + + +K++  G  ++ +TFNNT IT+TD  GN + WSS   +GF GS+K++P+AAQ A +
Sbjct: 3   KKKIKKSVARGVVYIAATFNNTVITVTDEMGNVLTWSSAGALGFKGSKKSTPYAAQQAVE 62

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAI-GFTIVSICDVTMIAHNGCRPRKRR 127
           D  +KA+ +G+  + +KV G G+GRD+A++++ AI G  ++   D+T + HNGCRP K+R
Sbjct: 63  DAMSKAKEYGIKEVGIKVQGPGSGRDTAVKSVGAIEGIRVIWFKDITPLPHNGCRPPKKR 122

Query: 128 RI 129
           R+
Sbjct: 123 RV 124


>gi|148284192|ref|YP_001248282.1| 30S ribosomal protein S11 [Orientia tsutsugamushi str. Boryong]
 gi|189183974|ref|YP_001937759.1| 30S ribosomal protein S11 [Orientia tsutsugamushi str. Ikeda]
 gi|172047208|sp|A5CCJ0|RS11_ORITB RecName: Full=30S ribosomal protein S11
 gi|226708393|sp|B3CT28|RS11_ORITI RecName: Full=30S ribosomal protein S11
 gi|146739631|emb|CAM79420.1| 30S ribosomal protein S11 [Orientia tsutsugamushi str. Boryong]
 gi|189180745|dbj|BAG40525.1| 30S ribosomal protein S11 [Orientia tsutsugamushi str. Ikeda]
          Length = 126

 Score =  120 bits (301), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 80/119 (67%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           ++RKNI  G  ++ STFNNT +T TD  GN IA  S   +GF G++K +P+AAQV  +  
Sbjct: 8   KKRKNITLGIVYIKSTFNNTIVTFTDMQGNAIAALSAGAIGFKGAKKATPYAAQVIVEKV 67

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           S  A+ HG+ +L +++ G G+ R+SALRA+    F + SI D + +AHNGCRP K+RR+
Sbjct: 68  SEVAKEHGIKTLSIRIQGAGSQRESALRAIFNQNFIVTSITDTSPVAHNGCRPPKKRRV 126


>gi|73913589|gb|AAZ91710.1| 30S Ribosomal protein S11 [Corynebacterium stationis]
          Length = 134

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 83/117 (70%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KN+  G A++ S FNNT ++ITDP G  I+WSS   VGF GSRK++PFAAQ+A +  + 
Sbjct: 18  KKNVAQGHAYIKSNFNNTIVSITDPSGAVISWSSSGQVGFKGSRKSTPFAAQMAAESAAR 77

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           KA  HGM  ++V V G G+GR++A+R+L+A G  + SI DVT   HNGCRP KRR +
Sbjct: 78  KAMEHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVSSISDVTPQPHNGCRPPKRRHV 134


>gi|223038534|ref|ZP_03608828.1| 30S ribosomal protein S11 [Campylobacter rectus RM3267]
 gi|222880391|gb|EEF15478.1| 30S ribosomal protein S11 [Campylobacter rectus RM3267]
          Length = 130

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 83/116 (71%), Gaps = 1/116 (0%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           +I  G  ++ +TFNNT +T+TD  GN IAWSS   +GF GS+K++P+AAQ A +D  AKA
Sbjct: 15  SIAKGIVYISATFNNTMVTVTDEMGNAIAWSSAGGLGFKGSKKSTPYAAQQAVEDALAKA 74

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAI-GFTIVSICDVTMIAHNGCRPRKRRRI 129
           + HG+  + +KV G G+GR++A++++ A+ G  +  + D+T + HNGCRP KRRR+
Sbjct: 75  KEHGIKEVGIKVQGPGSGRETAVKSVGAVEGIKVTFLKDITPLPHNGCRPPKRRRV 130


>gi|120437151|ref|YP_862837.1| 30S ribosomal protein S11 [Gramella forsetii KT0803]
 gi|152060592|sp|A0M575|RS11_GRAFK RecName: Full=30S ribosomal protein S11
 gi|117579301|emb|CAL67770.1| 30S ribosomal protein S11 [Gramella forsetii KT0803]
          Length = 133

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 84/128 (65%), Gaps = 2/128 (1%)

Query: 4   SPSRIRNRERKNIVS--GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           +P     ++RK +V   G AHV ++FNN  I++T+  G+ +AWSS   +GF GS+KN+P+
Sbjct: 6   NPKAKTQKKRKVVVESNGEAHVTASFNNIIISLTNKKGDVVAWSSAGKMGFRGSKKNTPY 65

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQ+A +D S  A   GM  ++V V G G GR+SA+RA+   G  +  I D+T + HNGC
Sbjct: 66  AAQLAAEDASKVAHEAGMRKVKVYVKGPGNGRESAIRAVHNSGIEVTEIIDITPLPHNGC 125

Query: 122 RPRKRRRI 129
           RP KRRR+
Sbjct: 126 RPPKRRRV 133


>gi|225873052|ref|YP_002754511.1| ribosomal protein S11 [Acidobacterium capsulatum ATCC 51196]
 gi|225793115|gb|ACO33205.1| ribosomal protein S11 [Acidobacterium capsulatum ATCC 51196]
          Length = 138

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 85/119 (71%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           RERKN+  G   + ++FNNT +TITD  GNT++W S   +GF GSRK +PFAAQ A  + 
Sbjct: 20  RERKNVPYGLVFIQASFNNTIVTITDGQGNTLSWKSSGSLGFRGSRKGTPFAAQQAAINA 79

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +  A++HG+ S++V+VSG G+GR+SA+RAL   G  + SI D T + HNGCRP KRRR+
Sbjct: 80  ANMARDHGLRSVDVRVSGPGSGRESAVRALAVAGLEVRSIRDTTPVPHNGCRPPKRRRV 138


>gi|152998248|ref|YP_001343083.1| 30S ribosomal protein S11 [Marinomonas sp. MWYL1]
 gi|189040420|sp|A6W369|RS11_MARMS RecName: Full=30S ribosomal protein S11
 gi|150839172|gb|ABR73148.1| ribosomal protein S11 [Marinomonas sp. MWYL1]
          Length = 130

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 79/111 (71%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G AHV ++FNNT +TITD  GN ++W++    GF GSRK++PFAAQVA +     AQ  G
Sbjct: 20  GVAHVHASFNNTIVTITDRQGNALSWATAGGSGFRGSRKSTPFAAQVAAERAGTVAQEFG 79

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + +++V + G G GR+SA+RAL A+G  I +I DVT I HNGCRP K+RR+
Sbjct: 80  LKNVDVMIKGPGPGRESAVRALNALGLRINNITDVTPIPHNGCRPPKKRRV 130


>gi|225010540|ref|ZP_03701011.1| ribosomal protein S11 [Flavobacteria bacterium MS024-3C]
 gi|225005369|gb|EEG43320.1| ribosomal protein S11 [Flavobacteria bacterium MS024-3C]
          Length = 130

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 84/121 (69%), Gaps = 2/121 (1%)

Query: 11  RERKNIVS--GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATD 68
           ++RK I+   G AHV ++FNN  I++T+  G+ I+WSS   +GF GS+KN+P+AAQ+A++
Sbjct: 10  KKRKVIIESVGEAHVTASFNNIIISLTNKKGDVISWSSAGKMGFRGSKKNTPYAAQLASE 69

Query: 69  DCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128
           DC+  A   G+  ++V V G G GR+SA+R++   G  +  I DVT + HNGCRP KRRR
Sbjct: 70  DCAKVAHEAGLRKVKVYVKGPGNGRESAIRSIHNAGIEVTEIIDVTPMPHNGCRPPKRRR 129

Query: 129 I 129
           +
Sbjct: 130 V 130


>gi|254423057|ref|ZP_05036775.1| ribosomal protein S11 [Synechococcus sp. PCC 7335]
 gi|196190546|gb|EDX85510.1| ribosomal protein S11 [Synechococcus sp. PCC 7335]
          Length = 130

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 63/119 (52%), Positives = 85/119 (71%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           +++KNI +G AH+ STFNNT +TITD  GN ++W+S    GF G++K +PFAAQ A D  
Sbjct: 12  KQKKNIPNGVAHIQSTFNNTIVTITDASGNAVSWASAGSSGFKGAKKGTPFAAQTAADGA 71

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + +A + GM   EV+VSG G+GR++A+RAL+  G  I  I DVT I HNGCRP KRRR+
Sbjct: 72  ARRAIDQGMRQCEVQVSGPGSGRETAIRALQGAGLEITLIRDVTPIPHNGCRPPKRRRV 130


>gi|310287999|ref|YP_003939258.1| 30S ribosomal protein S11 [Bifidobacterium bifidum S17]
 gi|309251936|gb|ADO53684.1| 30S ribosomal protein S11 [Bifidobacterium bifidum S17]
          Length = 132

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 91/129 (70%), Gaps = 1/129 (0%)

Query: 2   PKSPSR-IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           PK  +R  R R+RK+I  G+AH+ STFNNT I+ITDP G  ++W S   VGF GSRK++P
Sbjct: 4   PKQAARKPRRRDRKSIPVGQAHIKSTFNNTIISITDPSGAVVSWVSGGDVGFKGSRKSTP 63

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AA +A +  + KA  HG+  ++V V G G+GR++A+R+L++ G  + SI DVT  AHNG
Sbjct: 64  YAAGMAAESAARKAMEHGVKKVDVFVKGPGSGRETAIRSLQSAGLEVGSITDVTPQAHNG 123

Query: 121 CRPRKRRRI 129
            RP KRRR+
Sbjct: 124 VRPPKRRRV 132


>gi|283853177|ref|ZP_06370430.1| ribosomal protein S11 [Desulfovibrio sp. FW1012B]
 gi|283571435|gb|EFC19442.1| ribosomal protein S11 [Desulfovibrio sp. FW1012B]
          Length = 128

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 88/125 (70%)

Query: 5   PSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           P R   +ERKNI  G AH+ +TFNNT +T TD  GN ++W++    GF GSRK++PFAAQ
Sbjct: 4   PRRTGKKERKNIPVGVAHIQATFNNTIVTFTDQKGNVVSWATSGGAGFKGSRKSTPFAAQ 63

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           VA ++ + KAQ +GM ++ + V G G+GR++A+RA+   GF +  I D+T I HNGCRP 
Sbjct: 64  VAAENAARKAQENGMRTVGILVKGPGSGREAAMRAIHNAGFKVSFIRDITPIPHNGCRPP 123

Query: 125 KRRRI 129
           KRRR+
Sbjct: 124 KRRRV 128


>gi|237752999|ref|ZP_04583479.1| 30s ribosomal protein s11 [Helicobacter winghamensis ATCC BAA-430]
 gi|229375266|gb|EEO25357.1| 30s ribosomal protein s11 [Helicobacter winghamensis ATCC BAA-430]
          Length = 130

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 82/118 (69%), Gaps = 1/118 (0%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KNI  G  H+ + FNNT +TITD  GN I WS+   +GF GS+K++P+AAQ A +D  +
Sbjct: 13  KKNIARGIIHISAAFNNTSVTITDEMGNVICWSTAGALGFKGSKKSTPYAAQQAVEDAVS 72

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAI-GFTIVSICDVTMIAHNGCRPRKRRRI 129
           KA+ HG+  L VK+ G G+GR++A+++L +I G  ++   DVT + HNGCR  KRRR+
Sbjct: 73  KAKEHGIKELGVKIQGPGSGRETAVKSLGSIEGIKVLWFKDVTPLPHNGCRAPKRRRV 130


>gi|189501629|ref|YP_001957346.1| 30S ribosomal protein S11 [Candidatus Amoebophilus asiaticus 5a2]
 gi|189497070|gb|ACE05617.1| ribosomal protein S11 [Candidatus Amoebophilus asiaticus 5a2]
          Length = 130

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 58/124 (46%), Positives = 83/124 (66%), Gaps = 4/124 (3%)

Query: 9   RNRERKNIVS----GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ 64
           + + +K +VS    G+AH+ +T+NN  I++T+  G  I+WSS   +GF GS+KN+P+AAQ
Sbjct: 6   KEKTKKRVVSVGKLGQAHIKATYNNIIISMTNEIGQVISWSSAGKMGFKGSKKNTPYAAQ 65

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR 124
           V+  DC+  A   G+  +EV V G G GR+SA+R ++  G  I +I DVT I HNGCRP 
Sbjct: 66  VSAGDCAKVAHELGLRKVEVYVKGAGVGRESAIRTIQDAGIEISTIKDVTPIPHNGCRPP 125

Query: 125 KRRR 128
           KRRR
Sbjct: 126 KRRR 129


>gi|84494746|ref|ZP_00993865.1| 30S ribosomal protein S11 [Janibacter sp. HTCC2649]
 gi|84384239|gb|EAQ00119.1| 30S ribosomal protein S11 [Janibacter sp. HTCC2649]
          Length = 134

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 89/123 (72%)

Query: 7   RIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           ++R +++KN+  G+AH+ STFNNT I+ITDP G  IAW+S   VGF GSRK++PFAAQ A
Sbjct: 12  KVRRKDKKNVPVGQAHIKSTFNNTIISITDPTGAVIAWASAGQVGFKGSRKSTPFAAQTA 71

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
            +  + +A +HG+  ++V V G G+GR++A+R+L A G  + SI DVT   HNG RP KR
Sbjct: 72  AEAAARRAMDHGVRKVDVFVKGPGSGRETAIRSLTAAGLEVGSIQDVTPSPHNGVRPPKR 131

Query: 127 RRI 129
           RR+
Sbjct: 132 RRV 134


>gi|51209923|ref|YP_063587.1| ribosomal protein S11 [Gracilaria tenuistipitata var. liui]
 gi|62287422|sp|Q6B8X3|RR11_GRATL RecName: Full=30S ribosomal protein S11, chloroplastic
 gi|50657677|gb|AAT79662.1| 30S ribosomal protein S11 [Gracilaria tenuistipitata var. liui]
          Length = 129

 Score =  120 bits (300), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 86/119 (72%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           +++KNI++G  H+ STFNNT ITITD  G+T++WSS    GF G++K +PFAAQ+A +  
Sbjct: 11  KQKKNIINGITHIKSTFNNTLITITDLKGSTLSWSSAGASGFKGTKKGTPFAAQIAAEKA 70

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           + +A   G+   EV V+G GAGR++A+RAL+A G  I  I D+T I HNGCRP K+RR+
Sbjct: 71  AKQAIEQGIRQTEVLVNGPGAGRETAIRALQATGINITLIKDITPIPHNGCRPPKKRRV 129


>gi|152060572|sp|A1R8R6|RS11_ARTAT RecName: Full=30S ribosomal protein S11
          Length = 142

 Score =  120 bits (300), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 92/130 (70%), Gaps = 9/130 (6%)

Query: 9   RNRERKNIVSGRAHVVSTFNNT---------RITITDPHGNTIAWSSPKVVGFSGSRKNS 59
           R +++KNI  G+AH+ STFNNT          ++ITDP+G  I+W+S   VGF GSRK++
Sbjct: 13  RRKDKKNIALGQAHIKSTFNNTIVSITDPNGAVSITDPNGAVISWASAGEVGFKGSRKST 72

Query: 60  PFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHN 119
           PFAAQ+A +  + +AQ HG+  ++V V G G+GR++A+R+L+A G  + SI DVT  AHN
Sbjct: 73  PFAAQMAAEAAAKRAQEHGLRKVDVFVKGPGSGRETAIRSLQAAGLEVGSIQDVTPSAHN 132

Query: 120 GCRPRKRRRI 129
           GCRP KRRR+
Sbjct: 133 GCRPPKRRRV 142


>gi|284042829|ref|YP_003393169.1| 30S ribosomal protein S11 [Conexibacter woesei DSM 14684]
 gi|283947050|gb|ADB49794.1| 30S ribosomal protein S11 [Conexibacter woesei DSM 14684]
          Length = 132

 Score =  120 bits (300), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 89/128 (69%)

Query: 2   PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPF 61
           PK P R R R RKNI  G+AH+ ++FNNT +++TD  GN IAW S    GF GSRK++PF
Sbjct: 5   PKRPQRGRRRVRKNIPVGQAHIKTSFNNTIVSLTDREGNVIAWESAGGAGFKGSRKSTPF 64

Query: 62  AAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121
           AAQV  D  + K   HG+  +EV V G G+GR++A+R+L+A G  +  + DVT  AHNGC
Sbjct: 65  AAQVTADAAARKGIEHGLQKVEVFVKGPGSGRETAIRSLQAAGLEVTGVKDVTPQAHNGC 124

Query: 122 RPRKRRRI 129
           RPRKRRR+
Sbjct: 125 RPRKRRRV 132


>gi|193211876|ref|YP_001997829.1| 30S ribosomal protein S11 [Chlorobaculum parvum NCIB 8327]
 gi|226708343|sp|B3QR96|RS11_CHLP8 RecName: Full=30S ribosomal protein S11
 gi|193085353|gb|ACF10629.1| ribosomal protein S11 [Chlorobaculum parvum NCIB 8327]
          Length = 127

 Score =  120 bits (300), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 80/112 (71%)

Query: 18  SGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNH 77
            G  H+ ++FNN  +TITD  GNT++WSS    GF GS+KN+P+A+QV ++  + +A + 
Sbjct: 16  EGTVHIKASFNNIMVTITDTLGNTVSWSSAGKNGFRGSKKNTPYASQVTSEAAAKEAYDL 75

Query: 78  GMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           GM  ++V + G G+GRD+A+RAL+ +G  + SI D+T + HNGCRP KRRR+
Sbjct: 76  GMRYVDVLIKGPGSGRDAAIRALQGVGLEVRSIRDITPLPHNGCRPPKRRRV 127


>gi|296272960|ref|YP_003655591.1| 30S ribosomal protein S11 [Arcobacter nitrofigilis DSM 7299]
 gi|296097134|gb|ADG93084.1| 30S ribosomal protein S11 [Arcobacter nitrofigilis DSM 7299]
          Length = 130

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 82/116 (70%), Gaps = 1/116 (0%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI  G  H+ ++FNNT +TITD  GN IAWSS   +GF GS+K++PFAAQ A +D  AKA
Sbjct: 15  NIADGIVHIAASFNNTMVTITDRAGNAIAWSSAGNLGFKGSKKSTPFAAQAAVEDAMAKA 74

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAI-GFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ ++ +K+ G G+GRD+A++A+ A+ G  +  + DVT + HNGCR  KRRR+
Sbjct: 75  IEHGVKNVGIKIQGPGSGRDTAVKAVGAMEGIRVSWLKDVTPLPHNGCRAPKRRRV 130


>gi|227549866|ref|ZP_03979915.1| ribosomal protein S11 [Corynebacterium lipophiloflavum DSM 44291]
 gi|227078121|gb|EEI16084.1| ribosomal protein S11 [Corynebacterium lipophiloflavum DSM 44291]
          Length = 134

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 87/117 (74%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           +KN+ +G A++ STFNNT ++ITDP+G  I+W+S   VGF GSRK++PFAAQ+A ++ + 
Sbjct: 18  KKNVAAGHAYIKSTFNNTIVSITDPNGAVISWASSGHVGFKGSRKSTPFAAQMAAENAAR 77

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           KA  HGM  ++V V G G+GR++A+R+L+A G  + SI DVT    NGCRP KRRR+
Sbjct: 78  KAMEHGMKKVDVFVKGPGSGRETAIRSLQAAGLEVSSISDVTPQPFNGCRPPKRRRV 134


>gi|154174863|ref|YP_001409133.1| 30S ribosomal protein S11 [Campylobacter curvus 525.92]
 gi|166231809|sp|A7H0Z1|RS11_CAMC5 RecName: Full=30S ribosomal protein S11
 gi|112802251|gb|EAT99595.1| ribosomal protein S11 [Campylobacter curvus 525.92]
          Length = 130

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 83/116 (71%), Gaps = 1/116 (0%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           +I  G  ++ +TFNNT +T+TD  GN IAWSS   +GF GS+K++P+AAQ A +D   KA
Sbjct: 15  SIAKGIVYISATFNNTMVTVTDEMGNAIAWSSAGGLGFKGSKKSTPYAAQQAVEDALNKA 74

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAI-GFTIVSICDVTMIAHNGCRPRKRRRI 129
           + HG+  + +KV G G+GR++A++++ A+ G  +  + D+T +AHNGCRP KRRR+
Sbjct: 75  KEHGIKEVGIKVQGPGSGRETAVKSVGAVEGIKVTFLKDITPLAHNGCRPPKRRRV 130


>gi|260893346|ref|YP_003239443.1| 30S ribosomal protein S11 [Ammonifex degensii KC4]
 gi|260865487|gb|ACX52593.1| 30S ribosomal protein S11 [Ammonifex degensii KC4]
          Length = 128

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 87/124 (70%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           +R + +ER+ +    AH+ STFNNT +TITD  GNTIAW+S   VGF G+RK +PFAAQ+
Sbjct: 5   TRAKKKERRIVEKAVAHIKSTFNNTIVTITDLQGNTIAWASGGTVGFQGTRKGTPFAAQL 64

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A +  + +A  +G+  + V V G G+GR++A+R+L+A G  +  I DVT + HNGCRP K
Sbjct: 65  AAERAAKEAMEYGVREVAVLVKGPGSGREAAIRSLQAAGLQVSLIKDVTPVPHNGCRPPK 124

Query: 126 RRRI 129
           RRR+
Sbjct: 125 RRRV 128


>gi|229917332|ref|YP_002885978.1| ribosomal protein S11 [Exiguobacterium sp. AT1b]
 gi|259494624|sp|C4KZM0|RS11_EXISA RecName: Full=30S ribosomal protein S11
 gi|229468761|gb|ACQ70533.1| ribosomal protein S11 [Exiguobacterium sp. AT1b]
          Length = 131

 Score =  119 bits (299), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 63/127 (49%), Positives = 90/127 (70%)

Query: 3   KSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFA 62
           K   R + + +K++  G  H+ STFNNT ITITD  GN I+W++   +GF GSRK++PFA
Sbjct: 5   KQNVRSKRKVKKHVEVGVVHIRSTFNNTIITITDTQGNAISWATSGNLGFKGSRKSTPFA 64

Query: 63  AQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCR 122
           AQ+A +  +  A ++GM ++EV V G GAGR++A+RAL+A G  + +I DVT + HNGCR
Sbjct: 65  AQMAAETAAKVAMDNGMRTVEVNVKGPGAGREAAIRALQATGLEVTAIRDVTPVPHNGCR 124

Query: 123 PRKRRRI 129
           P KRRR+
Sbjct: 125 PPKRRRV 131


>gi|71083782|ref|YP_266502.1| 30S ribosomal protein S11 [Candidatus Pelagibacter ubique HTCC1062]
 gi|91763182|ref|ZP_01265146.1| ribosomal protein S11 [Candidatus Pelagibacter ubique HTCC1002]
 gi|91207666|sp|Q4FLP0|RS11_PELUB RecName: Full=30S ribosomal protein S11
 gi|71062895|gb|AAZ21898.1| ribosomal protein S11 [Candidatus Pelagibacter ubique HTCC1062]
 gi|91717595|gb|EAS84246.1| ribosomal protein S11 [Candidatus Pelagibacter ubique HTCC1002]
          Length = 150

 Score =  119 bits (299), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 63/115 (54%), Positives = 87/115 (75%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           NI++G A+V STFNNT I+I D +GN I+W+S    GF GSRK++P+AAQ+A D  ++KA
Sbjct: 36  NILNGIAYVQSTFNNTIISIADTNGNVISWASAGQKGFKGSRKSTPYAAQIAADSAASKA 95

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             +GM +L V+V G G+GR++ALRAL+A GF I+SI D T + HNG RP K+RR+
Sbjct: 96  LEYGMKTLSVEVKGPGSGRETALRALQARGFKILSIKDTTPMPHNGVRPPKKRRV 150


>gi|299138171|ref|ZP_07031351.1| 30S ribosomal protein S11 [Acidobacterium sp. MP5ACTX8]
 gi|298600101|gb|EFI56259.1| 30S ribosomal protein S11 [Acidobacterium sp. MP5ACTX8]
          Length = 141

 Score =  119 bits (299), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 63/119 (52%), Positives = 86/119 (72%)

Query: 11  RERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDC 70
           RERKN+  G   + ++FNNT +TITD  GNT++W S   +GF GSRK +PFAAQ A    
Sbjct: 23  RERKNVPFGLVFIQASFNNTIVTITDQTGNTLSWKSSGSLGFRGSRKGTPFAAQQAAVGA 82

Query: 71  SAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           +  A++HG+ S++V+V+G G+GR+SA+RAL A G  + SI DVT + HNGCRP KRRR+
Sbjct: 83  ANAARDHGLRSVDVRVAGPGSGRESAIRALAAAGIEVRSIRDVTPMPHNGCRPPKRRRV 141


>gi|189347678|ref|YP_001944207.1| 30S ribosomal protein S11 [Chlorobium limicola DSM 245]
 gi|226708342|sp|B3EGW5|RS11_CHLL2 RecName: Full=30S ribosomal protein S11
 gi|189341825|gb|ACD91228.1| ribosomal protein S11 [Chlorobium limicola DSM 245]
          Length = 127

 Score =  119 bits (299), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 86/123 (69%), Gaps = 3/123 (2%)

Query: 10  NRERKNIV---SGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVA 66
           +R+RK +     G  H+ ++FNN  +TITD  GNT++WSS    GF GS+KN+P+A+QV 
Sbjct: 5   SRKRKKVKVTPEGVVHIKASFNNVMVTITDVQGNTVSWSSAGKNGFRGSKKNTPYASQVT 64

Query: 67  TDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
           ++  + +A + GM +++V + G GAGRD+A+RAL+  G  + SI D+T + HNGCRP KR
Sbjct: 65  SEAAAKEAFDLGMRNVQVFIKGPGAGRDAAIRALQGAGLEVRSIRDITPLPHNGCRPPKR 124

Query: 127 RRI 129
           RR+
Sbjct: 125 RRV 127


>gi|46579738|ref|YP_010546.1| 30S ribosomal protein S11 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602785|ref|YP_967185.1| 30S ribosomal protein S11 [Desulfovibrio vulgaris DP4]
 gi|59798763|sp|Q72CF6|RS11_DESVH RecName: Full=30S ribosomal protein S11
 gi|152060587|sp|A1VE92|RS11_DESVV RecName: Full=30S ribosomal protein S11
 gi|46449153|gb|AAS95805.1| ribosomal protein S11 [Desulfovibrio vulgaris str. Hildenborough]
 gi|120563014|gb|ABM28758.1| SSU ribosomal protein S11P [Desulfovibrio vulgaris DP4]
 gi|311233529|gb|ADP86383.1| 30S ribosomal protein S11 [Desulfovibrio vulgaris RCH1]
          Length = 129

 Score =  119 bits (299), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 89/122 (72%)

Query: 8   IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67
           ++ RE+KN+  G AH+ +TFNNT +T TD  GNTI+W+S    GF GSRK++PFAAQ+A 
Sbjct: 8   VKKREKKNVPVGLAHIQATFNNTIVTFTDTRGNTISWASAGQSGFKGSRKSTPFAAQMAA 67

Query: 68  DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127
           +  + KAQ +GM ++ + V G G+GR++A+RA+ A GF +  I D+T I HNGCRP KRR
Sbjct: 68  EQAAKKAQENGMRTVGIYVKGPGSGREAAMRAINAAGFKVAFIRDITPIPHNGCRPPKRR 127

Query: 128 RI 129
           R+
Sbjct: 128 RV 129


>gi|187932569|ref|YP_001884500.1| 30S ribosomal protein S11 [Clostridium botulinum B str. Eklund 17B]
 gi|188587566|ref|YP_001919699.1| 30S ribosomal protein S11 [Clostridium botulinum E3 str. Alaska
           E43]
 gi|251780740|ref|ZP_04823660.1| 30S ribosomal protein S11 [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|187720722|gb|ACD21943.1| 30S ribosomal protein S11 [Clostridium botulinum B str. Eklund 17B]
 gi|188497847|gb|ACD50983.1| 30S ribosomal protein S11 [Clostridium botulinum E3 str. Alaska
           E43]
 gi|243085055|gb|EES50945.1| 30S ribosomal protein S11 [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 130

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 83/115 (72%)

Query: 15  NIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
           N+  G AH+ STFNN+ +T+TD  GN ++WSS   +GF GSRK++PFAAQ+A +  +  A
Sbjct: 16  NVEHGAAHIKSTFNNSIVTLTDAVGNALSWSSAGALGFRGSRKSTPFAAQMAAETAAKSA 75

Query: 75  QNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             HG+ S+EV V G G+GR++A+R+L+A G  +  I DVT I HNGCRP KRRR+
Sbjct: 76  MEHGLKSIEVYVKGPGSGREAAIRSLQAAGLEVTLIKDVTPIPHNGCRPPKRRRV 130


>gi|149371653|ref|ZP_01891069.1| 30S ribosomal protein S11 [unidentified eubacterium SCB49]
 gi|149355280|gb|EDM43840.1| 30S ribosomal protein S11 [unidentif