PSIBLAST alignment of GI: 254780238 and protein with PDB id: 1s1h

>gi|49258830|pdb|1S1H|K Chain K, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1h, Contains 40s Subunit. The 60s Ribosomal Subunit Is In File 1s1i Length = 136
 Score = 99.9 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 58/110 (52%), Gaps = 9/110 (8%)

Query: 17  VSGRAHVVSTFNNTRITITDPHGN-TIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQ 75
           V G A + ++FN+T + +TD  G  TIA  +  +   +   ++SP+AA +A  D +AK +
Sbjct: 12  VFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCR 71

Query: 76  NHGMSSLEVKV--------SGLGAGRDSALRALRAIGFTIVSICDVTMIA 117
             G++++ VK+           G G  +ALRAL   G  I  I DVT + 
Sbjct: 72  EVGITAVHVKIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVP 121